KEGG   Bacillus cereus E33L: pE33L466_0086Help
Entry
pE33L466_0086     CDS       T00198                                 

Gene name
celCCC
Definition
(GenBank) endoglucanase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
bcz  Bacillus cereus E33L
Pathway
bcz00500  Starch and sucrose metabolism
bcz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    pE33L466_0086 (celCCC)
Enzymes [BR:bcz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     pE33L466_0086 (celCCC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_8
Motif
Other DBs
NCBI-ProteinID: AAY60251
UniProt: Q4V206
Position
pE33L466:complement(88730..90121)
Genome map
AA seq 463 aa AA seqDB search
MVEKRTIFTVICACGIGFSSYTNCISAAALDNDTLINNGHKINSSIITNSSQVSAVAKEM
KPFPQQVNYSGILKPNHVSQESLNNAVKNYYNDWKKKYLKNDLSSLPGGYYVKGEITGNP
DGFRPLGTSEGQGYGMIITVLMAGHDSNAQTIYDGLFKTARAFKSSINPNLMGWVVADDK
KAQGHFDSATDGDLDIAYSLLLAHKQWGSSGKINYLKEAQNMITKGIKTSNVTKNNSLNL
GDWGDKSTFDTRPSDWMMSHLRAFYEFTGDKTWLNVIDNLYNTYTNFTNKYSPKTGLISD
FVVKNPPQPAPKDFLGESKYTDSYYYNASRVPLRIVMDYAMYGEKRGKVISDKVATWIKG
KTKGNPSKIVDGYKLDGTNIGDYPTAVYVSPFIAAGTTNSNNQEWVNSGWDWMKNKKESY
FSDSYNLLTMLFLTGNWWKPIPDEKKIQSSINLEVQSELKEQD
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaaaagaacgatattcaccgttatatgtgcatgtgggattgggttttcaagc
tatactaattgtatttcagcggcagctttagacaatgatacattaataaataatggacac
aaaatcaattcttctattataacaaactcttctcaagtatccgctgtcgctaaagaaatg
aaaccttttcctcaacaagtaaattactcaggaattttaaaaccgaatcatgtttcacag
gaaagtttgaataatgcagttaaaaattattataatgattggaagaagaagtatctaaag
aatgatttatcttcacttcctggtgggtattatgttaagggtgagataacgggaaatcca
gatgggtttagaccattaggaacttcagaaggacaaggatatgggatgattattacagtt
ttaatggcaggacatgattcaaatgctcagactatttatgatggcttatttaaaacagca
agagcttttaaaagttccataaacccaaatttaatggggtgggttgtagcagatgacaag
aaagcacaagggcattttgattctgcaacagatggggatttagacattgcttactcactt
cttcttgctcataagcaatggggatcaagtgggaaaattaattatttaaaagaagctcaa
aatatgattacaaaaggtattaagactagtaatgtgaccaaaaataatagtttgaattta
ggggattggggagacaaaagtacatttgatactagaccatccgactggatgatgtctcat
ttaagggcattctacgaatttacaggagataaaacttggcttaatgttattgataatctc
tacaatacttatacaaatttcacaaataaatattcaccaaagacaggattgatttctgat
tttgttgtgaaaaatccaccacagcctgcaccgaaagattttttaggtgaatcaaaatat
actgattcatattactataatgcgagtcgtgtaccactccgaattgttatggactatgca
atgtatggggaaaagagaggtaaggtgatttctgataaagttgctacatggataaagggt
aaaacaaaaggtaatccatctaaaattgtagacggctataaactagatggaacaaatatc
ggtgattatccaacagccgtatacgtttcgccctttattgccgctggtaccactaacagc
aataatcaggaatgggtaaatagtggttgggattggatgaagaataagaaagagagttat
ttcagtgatagttataatcttttgacaatgttatttttaacagggaattggtggaaaccg
attccagatgaaaaaaagatacaaagttcaataaatttagaagtacaatctgaattgaag
gaacaggattaa

DBGET integrated database retrieval system