KEGG   Bacillus cereus ZK: pE33L466_0086Help
Entry
pE33L466_0086     CDS       T00198                                 

Gene name
celCCC
Definition
chitosanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bcz  Bacillus cereus ZK
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bcz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pE33L466:complement(88730..90121)
Genome map
AA seq 463 aa AA seqDB search
MVEKRTIFTVICACGIGFSSYTNCISAAALDNDTLINNGHKINSSIITNSSQVSAVAKEM
KPFPQQVNYSGILKPNHVSQESLNNAVKNYYNDWKKKYLKNDLSSLPGGYYVKGEITGNP
DGFRPLGTSEGQGYGMIITVLMAGHDSNAQTIYDGLFKTARAFKSSINPNLMGWVVADDK
KAQGHFDSATDGDLDIAYSLLLAHKQWGSSGKINYLKEAQNMITKGIKTSNVTKNNSLNL
GDWGDKSTFDTRPSDWMMSHLRAFYEFTGDKTWLNVIDNLYNTYTNFTNKYSPKTGLISD
FVVKNPPQPAPKDFLGESKYTDSYYYNASRVPLRIVMDYAMYGEKRGKVISDKVATWIKG
KTKGNPSKIVDGYKLDGTNIGDYPTAVYVSPFIAAGTTNSNNQEWVNSGWDWMKNKKESY
FSDSYNLLTMLFLTGNWWKPIPDEKKIQSSINLEVQSELKEQD
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaaaagaacgatattcaccgttatatgtgcatgtgggattgggttttcaagc
tatactaattgtatttcagcggcagctttagacaatgatacattaataaataatggacac
aaaatcaattcttctattataacaaactcttctcaagtatccgctgtcgctaaagaaatg
aaaccttttcctcaacaagtaaattactcaggaattttaaaaccgaatcatgtttcacag
gaaagtttgaataatgcagttaaaaattattataatgattggaagaagaagtatctaaag
aatgatttatcttcacttcctggtgggtattatgttaagggtgagataacgggaaatcca
gatgggtttagaccattaggaacttcagaaggacaaggatatgggatgattattacagtt
ttaatggcaggacatgattcaaatgctcagactatttatgatggcttatttaaaacagca
agagcttttaaaagttccataaacccaaatttaatggggtgggttgtagcagatgacaag
aaagcacaagggcattttgattctgcaacagatggggatttagacattgcttactcactt
cttcttgctcataagcaatggggatcaagtgggaaaattaattatttaaaagaagctcaa
aatatgattacaaaaggtattaagactagtaatgtgaccaaaaataatagtttgaattta
ggggattggggagacaaaagtacatttgatactagaccatccgactggatgatgtctcat
ttaagggcattctacgaatttacaggagataaaacttggcttaatgttattgataatctc
tacaatacttatacaaatttcacaaataaatattcaccaaagacaggattgatttctgat
tttgttgtgaaaaatccaccacagcctgcaccgaaagattttttaggtgaatcaaaatat
actgattcatattactataatgcgagtcgtgtaccactccgaattgttatggactatgca
atgtatggggaaaagagaggtaaggtgatttctgataaagttgctacatggataaagggt
aaaacaaaaggtaatccatctaaaattgtagacggctataaactagatggaacaaatatc
ggtgattatccaacagccgtatacgtttcgccctttattgccgctggtaccactaacagc
aataatcaggaatgggtaaatagtggttgggattggatgaagaataagaaagagagttat
ttcagtgatagttataatcttttgacaatgttatttttaacagggaattggtggaaaccg
attccagatgaaaaaaagatacaaagttcaataaatttagaagtacaatctgaattgaag
gaacaggattaa

DBGET integrated database retrieval system