KEGG   Bifidobacterium dentium: BDP_0049Help
Entry
BDP_0049          CDS       T01143                                 

Gene name
pldB
Definition
lysophospholipase PldB (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bde  Bifidobacterium dentium
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bde00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
59078..60142
Genome map
AA seq 354 aa AA seqDB search
MTITLIDEAHYDAEMDAKVLPALQACLTEGRMKPATHDSDGKALPTLDNPGTLHYCCYDV
RKFNESRGGRSAGPFRGAVVISHGFTEFGRKYSEMVWYFLLAGYSVCVFEHRGHGHSAHD
MSNPSLVWIDDWRRYVADFATFASTVGREYAMGRPLDLYCHSMGGGIGAAVLERYPSLFD
KAVLSAPMIAPAVGMPTWVARIVVGGICALGFGKSRVFGHADFSDNLNLDDYRGASEARI
RWFHKQRLADECCWTNAATFEWANQAMALSRAVLKPDMCGAIETPTLLFQAGLDVWVLNG
PQDEFIERVREGGGSIEKVRYDQSLHEIFSMPNDVVGPYLKRILDFLGAHDVGL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgactatcacgctcatcgatgaggcgcattacgacgccgaaatggacgctaaggtgctt
ccggcgctgcaagcctgcctgacggaagggcgtatgaagccggcgacgcacgacagcgac
ggcaaggcgttgcctacgctcgataatcccggcacgttgcactattgctgctacgacgtc
cgaaaattcaacgaatcgcgcggaggcaggtcggcgggaccgttccgcggagcggtcgtc
atctcccacggtttcaccgaattcggacgcaaatacagcgagatggtgtggtacttcctg
ctcgcaggctattccgtatgcgtattcgagcatcgcggtcacggccattccgcgcatgac
atgagcaatccgagtttggtctggatcgatgactggcgtcgatatgtagctgatttcgca
acattcgccagcaccgtcggacgcgagtatgcaatgggtcggccgctcgacctgtactgc
cattccatgggcggcggcattggcgcggccgtgctggaacgttatccgagtctattcgac
aaggcggtgctgtccgcaccgatgatcgcaccggcggtcggtatgccgacgtgggtcgcg
cgcatcgtcgtcggcggtatttgcgcactgggattcggcaaaagccgagtgttcgggcat
gccgacttttccgacaatctcaatctggacgattatcgcggcgcgtccgaagcgcgcatc
cgctggttccacaagcaacggctcgccgacgaatgctgttggaccaatgcggcgaccttc
gagtgggcgaatcaggccatggcgctatcccgtgcggtgctcaaacccgacatgtgcggt
gccattgagacgccgacgctgctcttccaggccgggcttgacgtgtgggtgctcaacggt
ccgcaggacgagttcatcgaacgtgtgcgcgaaggtggcggttccatagagaaggtgcgc
tacgaccagtcgttgcacgagatcttctccatgccgaacgatgtggtcggtccgtatctg
aagcgaatcctcgatttccttggcgcgcacgacgtaggcttgtag

DBGET integrated database retrieval system