KEGG   Bifidobacterium dentium: BDP_0109Help
Entry
BDP_0109          CDS       T01143                                 

Definition
sucrose phosphorylase (EC:3.2.1.54)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bde  Bifidobacterium dentium
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bde00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
128033..129547
Genome map
AA seq 504 aa AA seqDB search
MKNKVQLITYADRLGDGTIKSMTDILRTRFDGVYDGVHILPFFTPFDGADAGFDPIDHTK
VDPRLGDWNDVAELSTTHDIMVDAIVNHMSWESEQFQDVLANGEESEYYPMFLTMSSVFP
NGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSDKGWEYLMSIFDQ
MAASHVSYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEGVKRGLEILIEVHSYYKKQ
VEIASKVDRVYDFALPPLLLHSLNTGHVEPVAHWTDIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDNLVNAIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YIAARAVQFFLPGVPQVYYVGALAGRNDMELLRKTNNGRDINRHYYSTAEIDENLERPVV
KALNALAKFRNELDAFDGEFSYEADGDTSISFTWKGDATSATLTFEPGKGLGVDNTASVA
TLAWTDAAGDHRTDDLIAEPPVVA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaaagtgcagctcatcacttatgctgaccgtttgggcgacggcaccatcaag
tcgatgaccgatatcctgcgcacccgcttcgacggtgtgtacgacggcgtgcatatcctg
ccgtttttcaccccgttcgatggcgccgacgcgggttttgacccgatcgaccacaccaag
gtcgatccacgtctcggcgactggaacgatgtcgccgagctttccacgacccacgacatc
atggtcgacgccatcgtcaaccacatgagctgggaatccgagcagttccaggacgtgctc
gccaacggtgaggaatccgagtactacccgatgttcctgaccatgagctccgtcttcccg
aacggcgccaccgaagaggatctggccggcatttaccgtccgcgtccgggtctgccgttc
acccactacaagttcgccggcaagacccgtctggtgtgggtgagcttcaccccgcagcag
gtcgacatcgacaccgactccgacaagggttgggaatacctcatgtcgattttcgaccag
atggcagcctcgcatgtgagctacatccgtctcgacgccgtcggctacggcgccaaagag
gccggcaccagctgtttcatgaccccgaagaccttcaagctgatctcccgcctacgcgaa
gagggcgtcaagcgtggtcttgagattctcatcgaagtgcattcctactacaagaagcag
gtcgagatcgcctcgaaggtcgatcgcgtctacgatttcgccctgccgccgttgctgctg
cactcgctgaatacgggccacgtcgagccggtcgcgcactggaccgacatccgtccgaac
aatgccgtcaccgtgctcgatacgcacgatggcatcggcgtgatcgacatcggctccgat
cagctggatcgttcgctcaagggccttgtgccggatgaggacgtcgacaacctcgtcaac
gccattcacgccaacacccatggcgagtcccaggctgcgaccggtgccgccgcctccaat
ctcgacctgtaccaggtcaacagcacctactactcggcattgggatgcaacgaccagcac
tacatcgccgcccgcgccgtgcagttcttcctgccgggcgtcccccaggtctactacgtc
ggcgccctcgccggcaggaacgacatggagctgctgaggaagaccaacaacggccgcgac
atcaaccgccactactactccaccgcggagatcgacgagaatctcgaacgcccggtcgtc
aaggcgctgaatgccttggcgaagttccgcaacgagctcgacgccttcgacggtgaattc
tcctacgaggccgatggtgacacgtccatcagcttcacctggaagggcgacgccacctcc
gccacgctcaccttcgagccaggcaagggtcttggcgtcgacaacaccgcttcggtcgcc
acgctcgcgtggaccgatgccgccggcgatcaccgtaccgacgatctgatcgccgagccg
ccggtcgttgcctga

DBGET integrated database retrieval system