KEGG   Bifidobacterium dentium: BDP_0222Help
Entry
BDP_0222          CDS       T01143                                 

Definition
glycosyl hydrolase family 2 (EC:3.2.1.31)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bde  Bifidobacterium dentium
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BDP_0222
  Lipid metabolism
   00600 Sphingolipid metabolism
    BDP_0222
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BDP_0222
Enzymes [BR:bde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BDP_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
277850..280360
Genome map
AA seq 836 aa AA seqDB search
MQAADFNAGWAYRHLDADEDWTAVTIPHDAMLYEPRHALAASGLNSGWFEGRDYEYVKHF
MPERDMAGSRMLLEFEGVYHHAEVWVNGEKAAFRPYGYTNFYVDLTGRVRFGEDNEIRVI
ARNADQPNSRWYSGAGIYRPVTLWTSPAEHIAVDGLFVRTIAADPANGTARIRVEVETTA
EGSVHIEIADMAGGIAASVTQPCEAGVNRYELGIADAKPWSVNRPELYVCTARYTTQHGD
SDEAATTFGIRTLEWGSGGLLINGERVIIQGACIHHDNGVLGACAYADAEERKIRLMKAN
GYNAIRSAHNPCSKALLEACDRLGVLVMDEYIDHWYIHKTQHDYVDYFDEWWRRDLADMV
MKDRNHPSVILYSTGNEVSETAQKRGIALTRAMTEYLHALDDSRPVTCGVNIFFNFLSSI
GFGQYSDKKAAKEAEAAEKRRAAGQAADKHKAVGSEFFNNMAGVLGADFMKTGAALPFCD
WVTRDAFAAMDVAGYNYGIKRYVHDLKKYPDRLILGSETFCNDAYRFRELAKREPRLIGD
FVWAGMDYIGETGVGAWEYEDYATLNIEYGWLTAGSGRVDLTGRALGEAYYTRVALEEAS
GPWLAVCPVNHTGDKHSPSAWKMSNAIDSWSWNGCEGRKANVEVYARAASVSLVLNGREI
GRKAMRNDCIACFSCTYEPGTLEAVAYDESGREIGRNQLVSASAETRLNASVEYTGRELA
YVRVRYTDGHGVTKPLERGTLRATLIGPDGKGGGAGGDADEAVGGAKLLGFGCAAPCNKG
SFVTGETGTYYGEALAVVRMPQSQEGTAVLHISDGRLSAQVSVEPIGIVNRADSTR
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagcagatttcaatgcaggctgggcctatcgccatcttgacgccgatgaggat
tggaccgccgttacgattccacatgatgcgatgctgtatgagccgcgccatgcgctcgcg
gcaagtggattgaattccggctggttcgaaggtcgcgattatgaatacgtcaagcatttc
atgccggaacgggatatggccggcagtcggatgctgcttgaattcgagggcgtctatcat
catgccgaggtgtgggtgaacggtgagaaggcggcgtttcgcccatacggatacaccaat
ttttacgttgatctgaccggccgcgttcgtttcggtgaagacaatgagattcgcgtgatt
gcacgcaatgccgatcagccgaattcccgttggtactccggagctggtatctaccgtccc
gtcacgttgtggacgtcgcccgccgagcatatcgccgtggacggtctcttcgtgcgtact
atcgccgcggatccggcgaatggcaccgcacgtatccgcgtcgaggtcgaaacgactgcg
gaaggcagtgtgcacattgaaatcgccgacatggcgggtgggatcgcagccagtgtcacg
caaccatgcgaggctggggtaaacaggtatgagctcggcattgccgacgcgaaaccatgg
tccgtgaaccgtccggaactgtacgtgtgcaccgcgcgttacaccacgcaacatggggat
tccgacgaggctgcgaccacgttcggtatccgtacgctcgaatgggggagcgggggactg
ctgatcaacggcgagcgcgtgatcatccagggcgcgtgcatccatcatgacaacggcgtg
cttggcgcatgcgcgtatgccgacgccgaggagcgcaagattcgtctgatgaaggcgaat
ggctacaatgccatccgttccgcgcacaatccgtgttcgaaagcactgttggaggcgtgt
gaccgacttggtgtgctggtgatggatgagtatatcgaccattggtatattcataagacg
cagcatgattacgttgattatttcgacgaatggtggcgtcgggatcttgccgacatggtg
atgaaggatcgcaaccatccgagtgtgatactgtactccaccggtaatgaggtgtcggaa
acggcgcagaagcgcggtattgcgctcacgcgtgcgatgactgaatatctgcatgcgctt
gacgactcccgtcctgtcacctgcggtgtgaacatcttcttcaattttctttcgtcgatc
ggctttggccagtattccgacaagaaggccgcgaaggaggccgaggccgccgagaagcgc
cgtgccgcaggacaggccgccgacaagcataaggctgtcggcagtgagttcttcaacaat
atggccggcgtgctgggcgccgatttcatgaagaccggtgctgcgctgccgttttgcgat
tgggtgacgcgagatgcgttcgccgcgatggacgtggccggctacaactatggcatcaag
cgatatgttcacgacctgaagaagtatccggatcgactgattctcggctccgaaaccttc
tgcaacgatgcataccgcttccgcgagctcgccaaacgcgaaccgcggctgattggcgac
ttcgtatgggcgggcatggattacatcggtgaaaccggcgtgggggcctgggagtacgag
gattatgcgaccttgaacatcgaatacggctggctgaccgccggttcgggacgggtggac
ctgaccggccgcgcattgggtgaggcatattacacgcgtgtggcgttggaggaggcttcc
ggaccatggttggctgtctgcccggtgaaccatacgggagacaagcattcgccgagcgcg
tggaagatgagcaacgccatcgactcgtggagctggaatggctgcgaaggccgcaaggcg
aacgttgaggtctacgcgagggccgcgtccgtctccttggtgctcaacggccgtgaaatc
ggacgcaaggcaatgcgcaacgattgcatcgcctgtttctcatgcacatacgagccgggc
acgctggaagccgtggcctacgatgaatccggccgtgaaatcggccgcaatcagttggtc
agcgcttctgccgaaacacgattgaacgcatccgtggaatatacgggtcgtgaacttgcg
tacgtgcgcgtgcgctacaccgatgggcacggcgtgaccaaaccacttgagcgaggcacg
ttacgtgcgacactgatcggtcccgacggcaagggaggcggggccggcggagacgctgac
gaagctgtcggcggagcgaaactgctcggtttcggttgcgccgcaccttgcaacaagggc
agcttcgtcaccggcgaaaccggcacctactatggcgaggcgctcgccgtggtgaggatg
ccgcagtcgcaagaaggtacggcggtgctgcacataagcgacggcaggctatcggcgcag
gtgagcgtcgagccgatcggcatcgtgaatcgtgcggattcgacgaggtag

DBGET integrated database retrieval system