KEGG   Bifidobacterium dentium: BDP_0229Help
Entry
BDP_0229          CDS       T01143                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bde  Bifidobacterium dentium
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BDP_0229 (recR)
DNA repair and recombination proteins [BR:bde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BDP_0229 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
289078..289680
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDAFAHLPGIGPKGAQRIAFYMLNASDEESQGLIDAITEVKEKVRFCE
ICGNVCETSPCPVCVDPRRDRSVICVVEEPKDVMSIERTREYRGLYHVLGGAINPMANVQ
PSDLNIAKLIERLKDSEVKEVILALNPNVEGEATTSFLAQLLSQTDIKVTRLASGLPVGG
DLEYADEITLGRALAGRRNV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcctatgacggcgccatccagcgcctcatcgacgcattcgcgcacctgccc
ggcatcgggccgaaaggagcgcaacgtatcgccttctacatgcttaacgcctccgatgag
gagtcgcagggcctgattgacgccatcaccgaagtcaaggagaaggtgcgattctgcgaa
atctgcggcaatgtgtgcgagaccagcccctgcccggtgtgtgtggaccctcgtcgcgat
cgtagcgtgatttgcgtggtggaggagccgaaggacgtgatgagcatcgagcgcacgcgc
gaataccgtggcctgtaccatgtgctcggcggggcgatcaatccgatggcgaacgtgcag
ccgagcgatctgaacatcgccaaactcatcgagcggttgaaggacagcgaagtcaaggag
gtgattctcgcactcaatccgaacgtggaaggcgaggccaccaccagcttcctcgcacag
ctgctctcgcagaccgacatcaaggtgacgcgtctggccagcggcctgccggtgggcggc
gacctcgagtatgccgacgaaatcaccttggggcgtgccctcgccggtcgccgcaatgtc
tga

DBGET integrated database retrieval system