KEGG   Bifidobacterium dentium: BDP_0426Help
Entry
BDP_0426          CDS       T01143                                 

Gene name
adh2
Definition
aldehyde-alcohol dehydrogenase 2 (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bde  Bifidobacterium dentium
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BDP_0426 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDP_0426 (adh2)
   00620 Pyruvate metabolism
    BDP_0426 (adh2)
   00650 Butanoate metabolism
    BDP_0426 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    BDP_0426 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BDP_0426 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BDP_0426 (adh2)
   00626 Naphthalene degradation
    BDP_0426 (adh2)
Enzymes [BR:bde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BDP_0426 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BDP_0426 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523994..526726
Genome map
AA seq 910 aa AA seqDB search
MADAKKKEEPTKPTPEEKLAAAQAEVDELVNKGLKALDEFEKLDQKQVDRIVAKASVAAL
NKHLVLAKMAVEETGRGLVEDKATKNIFACEHVTNYLAGQRTVGIIREDDVMGIDEIAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQNCSVAAAKIVRDAAIEAGAP
ENCIQWIEHPSIEATGALMKHDGIATILATGGPGMVKAAYSSGKPALGVGAGNAPAYIDR
NVDVVRAANDLILSKHFDYGMICATEQAIIADKEIYAPLIKEMKRRKAYFVNDEEKAKLE
QYMFGCTSYSGQTPKLNSVVPGKSPQYIAKAAGFDIPEDVTILAAECKEVGENEPLTMEK
LAPVQAVLKSENKEQGFEMCEAMLKHGAGHTAAIHTNDQALVREYGQRMHACRIIWNSPS
SLGGVGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLLNIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGVVDKIIDQLRARSNRVTFRIIDYVEPEPSV
ETVERGAAMMREEFEPDTIIAVGGGSPMDASKIMWLLYEHPEISFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSFEAFVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGEDKIKA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHVAHGRTNSILLPYVIRYNGSIPEEP
TSWPKYNKYIAPERYQEIAKNLGINPGKTPAEGVENLAKAVEDYRDNKLGMNKSFQECGV
DEDYFWSVLDQIGMRAYEDQCAPANPRIPQIEDMKDIAIAAYYGVSQEEGHKLRVQRQGE
AATEEASERV
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtggcagacgcaaagaagaaggaagagccgaccaagccgactccggaggagaagctcgcc
gcagctcaggccgaggtcgatgagctggtgaataagggcctgaaggcgctcgacgaattc
gagaaactcgatcagaagcaggtcgaccgcatcgtcgccaaggcctccgtcgccgccttg
aacaagcatctggtgctcgccaagatggccgttgaggaaaccggccgtggtctggtcgaa
gacaaggccaccaagaacatcttcgcgtgcgagcatgtcaccaactatctggctggacag
cgcaccgtcggcatcatccgcgaagacgacgtgatgggcatcgacgagatcgccgaaccg
gtcggcgtcgtcgccggcgtgactccggtcaccaatccgacctccaccgccatcttcaag
tccctgatcgcgctcaagacccgttgtccgatcgtcttcggcttccacccgggcgcgcag
aactgctccgtggccgccgcgaagatcgtgcgcgacgccgccatcgaggctggtgctccg
gagaactgtatccagtggatcgagcatccgtccatcgaggccaccggcgccctgatgaag
catgacggcatcgcaaccatcctcgccaccggtggtccgggcatggtcaaggccgcttat
tcctccggcaagccggcccttggcgtcggtgccggcaacgctccggcctacatcgacagg
aacgtggacgtggtgcgtgccgccaacgacctgattctgtccaagcatttcgactatggc
atgatctgcgccaccgagcaggccatcatcgccgacaaggagatctacgctccgctcatc
aaggagatgaagcgtcgcaaggcctacttcgtgaacgatgaggagaaggccaagctcgag
cagtacatgttcggctgcacctcctattccggccagaccccgaagctcaactccgtggta
ccgggcaagtctccgcagtacatcgccaaggccgcaggcttcgacattccggaagacgtc
accatcctcgccgccgagtgcaaggaggtcggcgagaacgaaccgctcaccatggagaag
ctcgctccggtgcaggcggtgctgaagtccgaaaacaaggaacagggcttcgagatgtgc
gaagccatgctcaagcatggcgcaggccacaccgcggccatccacaccaacgatcaggcc
ctggtacgcgaatacggccagcgcatgcacgcatgccgcatcatctggaactccccgagc
tcccttggcggcgtgggcgacatctacaacgccatcgcaccgtccctgaccttgggttgc
ggctcctacggcggcaactccgtgtccggcaacgttcaggcagtcaatcttctcaacatc
aagcgcatcgctcggaggaacaacaacatgcagtggttcaagattccggccaagacctac
ttcgagccgaacgccatcaagtatctgcgcgacatgtacggcatcgaaaaggccgtcatc
gtgtgcgacaaggtcatggagcagcttggcgtggtcgacaagatcatcgaccagctgcgc
gcacgttccaaccgcgtgaccttccgcatcatcgattacgtcgagccggagccgagcgtc
gaaaccgtcgaacgcggtgccgccatgatgcgcgaggagttcgaaccggacaccatcatc
gccgtcggcggtggttccccgatggacgcctccaagatcatgtggctgctgtacgagcac
ccggagatctccttctccgacgtgcgcgagaagttcttcgacatccgtaagcgcgccttc
aagattccgccgctgggcaagaaggccaagctcgtgtgcatcccgacctcgtccggcacc
ggttccgaagtcacgccgttcgccgtgattaccgaccacaagaccggctacaagtacccg
atcaccgattatgcgctgaccccgtccgttgccatcgtcgatccggtgctggcccgcacc
cagccgcgcaagctggcttccgacgctggcttcgacgcgctgacccactccttcgaggcc
ttcgtgtccgtctatgccaacgatttcactgatggcatggcactgcacgcagccaagctg
atctgggacaatctggccgaatccgtcaacggcgagccgggcgaagacaagatcaaggct
caggagaagatgcacaacgccgccaccatggcgggcatggccttcggctccgccttcctc
ggcatgtgccatggcatggcccacaccatcggcgccctgtgccacgtggcccacggccgt
accaactccatcctcctgccgtatgtgatccgttacaacggttccattccggaggagccg
accagctggccgaagtacaacaagtacatcgctccggaacgctaccaggaaatcgccaag
aaccttggtatcaatccgggcaagaccccggccgaaggtgtcgagaacctggccaaggcc
gtcgaggactaccgcgataacaagctcggtatgaacaagagcttccaggaatgcggcgtg
gacgaggattacttctggtccgttctcgatcagatcggcatgcgcgcctacgaagaccag
tgcgctccggcgaacccgcgtatcccgcagatcgaggatatgaaggacatcgccatcgcc
gcctactacggcgtcagccaggaggagggccacaagctgcgcgtccagcgtcagggcgag
gccgccacggaggaagcctccgagcgcgtgtga

DBGET integrated database retrieval system