KEGG   Bifidobacterium dentium Bd1: BDP_0487Help
Entry
BDP_0487          CDS       T01143                                 

Definition
(GenBank) putative glycosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00052  Galactose metabolism
bde00561  Glycerolipid metabolism
bde00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BDP_0487
  Lipid metabolism
   00561 Glycerolipid metabolism
    BDP_0487
   00600 Sphingolipid metabolism
    BDP_0487
Enzymes [BR:bde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BDP_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_31
Motif
Other DBs
NCBI-ProteinID: ADB09161
UniProt: D2Q8M5
Position
576923..579061
Genome map
AA seq 712 aa AA seqDB search
MERQYMWGNDSVSLAFEVNADEHVSLSRIVFGMVEKVFAQRLPLAEIILSGTGHWIACDR
LIHTTIGRDLVLLSFDERTKGESRCLDVKMRDEQHALDVVVTYVISPGTSVVCAYATVIN
RGAGHVFLESVTSAVLPMGSMSNDETWKKEWILLEGHYDWLGEGRWSYTKCSDLFPVLRQ
ELTNHNPRSEHAVVSTGTWSTGGSVPMAFLESRETGNVWAFQVEHNGAWRWEIGDNTVDG
YFALSGPTSVNHSWMKDLGEGESFATVPASFVMGGDMQTTVEEMTKYRRIGRLVDESSAV
SQVIFNDYMNTINGDPTTEKLLPLISSAAQVGCEVFVIDCGWYDDSGDWWPSVGEWKPSK
TRFPGPRGIGEVIDAIKEAGMVPGLWLEPEVIGIKSPVAQELPDSAFFQRNGQRVVEQER
YILDLRDESARRYLDGVVDRLIGDYGVQYFKMDYNVSPGAGTDYHADSVGDGLLGHNRAF
LDWVDGLHRRYPKLILENCSSGGMREDFAQTSRFQVQSTSDQQDYRLYPVIAATAPLMVL
PEQAASWAYPQAEMDAEQTAFNINTTFLGRFFLSGYINQMEEWQKNIIQQGIQAYREHVQ
PMIGESVPLWPLGLPSWDSAVVALGVKASRRTIVTVWARNAPETVKEVALFLPHLHGEGV
QCRTIFPVGPAFDEWDAKWSEADSSLIVSIPHGMYASRSFELVEKGGETLLS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggcaatatatgtggggaaacgatagcgtgtctcttgccttcgaagtgaatgcg
gacgagcatgtatcgctttcccgcatcgtctttgggatggtggagaaggtttttgcacaa
aggctgccgcttgcggaaatcatcctctccggtacgggacattggatcgcatgtgatcgg
ctgatacatacgaccatcggcagggatttggtccttttgtcgtttgatgagaggactaag
ggggagtcgcgatgtcttgacgtcaaaatgagggatgagcaacatgctctcgatgtggtc
gtgacatatgtgatttctccgggaacgtccgtggtctgcgcatatgcgacggttatcaac
aggggggcggggcatgtgtttcttgagtcggtgaccagtgccgttcttcctatggggtcg
atgtctaatgatgagacctggaagaaggaatggatcctgcttgaaggtcattatgattgg
cttggcgaggggcgttggtcctatacgaaatgctcggatctgttcccagtgcttcgtcag
gagcttacgaatcataatccgcgcagtgagcatgctgtcgtttccacgggaacatggtct
acgggcggatcggtgccgatggcgttcttggagagccgggagacgggcaatgtgtgggct
ttccaggttgagcataatggcgcatggcgttgggaaatcggcgacaacacagtggatgga
tacttcgcgttgtccggccctacgagcgtcaatcattcatggatgaaggatttgggggaa
ggcgagtctttcgcgactgtgccggcgtcgttcgtcatgggtggggacatgcagaccacc
gttgaggaaatgacgaaataccggcgaatcggaaggttggtcgatgagtcgtccgctgtt
tcccaagtgatattcaacgactatatgaatacgataaatggcgacccgaccacggaaaag
ttgttgccgctgatttcaagcgcggcgcaggttggttgcgaggtcttcgtcatagattgc
ggctggtatgacgattccggcgattggtggccgagcgtcggagagtggaagccgtcaaaa
accagattcccggggcctaggggaatcggggaagtgattgatgcgattaaagaggcggga
atggttcccggtctctggctggagcccgaagtcattggaatcaaatcacctgttgcgcaa
gagcttcctgactctgcgttcttccaacgcaacgggcagcgtgtggttgagcaggagcgg
tatatccttgatctgcgcgatgagtctgcccgccgatatttggatggcgttgtggatcga
ctgatcggtgactatggcgttcagtacttcaaaatggattacaacgtctctccaggggct
ggaaccgactaccacgctgattcggtgggggatggattgcttggccataatcgagccttc
cttgattgggttgatggtctgcatcgtagatatccgaaattgattcttgaaaattgttct
tcaggtggaatgcgtgaggattttgcccagacgtccagattccaagtgcaatccacatct
gatcagcaggactaccgcttgtacccggttattgcggcgacggctccgttgatggtactg
ccggagcaggctgccagttgggcgtatccgcaggccgagatggatgcggagcagacggcg
ttcaatatcaataccacgttcttggggcgtttcttcctttccggatacatcaatcaaatg
gaagagtggcagaagaacattatccagcaaggtattcaggcctatcgagagcatgtgcag
ccgatgattggggagtcggtgcccctctggccgcttgggttgccatcgtgggattctgcg
gtggtggcgttgggtgtgaaggcctctcggcggacgatagtcaccgtgtgggcgaggaac
gctccggaaacggtgaaggaggttgcgctcttcttgccacacttacacggcgagggcgtt
caatgccgaacgattttcccggttggtcccgcttttgatgaatgggatgccaaatggtca
gaagctgattcgagtcttatcgtgtccattccgcatggaatgtatgcgtcaagatctttc
gaactcgttgagaaaggcggtgaaacccttctttcgtag

DBGET integrated database retrieval system