KEGG   Bifidobacterium dentium: BDP_0550Help
Entry
BDP_0550          CDS       T01143                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bde  Bifidobacterium dentium
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bde00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649607..650245
Genome map
AA seq 212 aa AA seqDB search
MSDTEAFDTMLDDKARAAHAAGPVGYDEEGVRQAVRLFLRSIGEDPDREGLLDTPNRIGR
ACRELFAGLGHGPEEVLKTKFKVDTDEMVLVRDIELFSVCEHHLLPFHGVAHVGYIPSNG
QVAGLSKLARLVELYARRPQVQERLTQQVADALMTGIEARGVIVVTECDHMCMAMRGVKK
PQSRTVTSAVRGCMRDAATRSEAMSLILSQHS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataccgaagcattcgataccatgcttgacgacaaggcccgcgccgctcatgcg
gccgggcctgtcggctatgacgaggaaggcgtacgccaggcggtacgcctgtttttgcga
tccatcggcgaagacccggatcgcgaaggcctgctcgacacccccaatcgcatcggccgt
gcatgcagggaattgttcgccggtctggggcacggtcccgaagaggtactgaaaaccaag
ttcaaggtcgacaccgacgaaatggtgttggtgcgtgacatcgagctgttctccgtatgc
gagcatcatctgctgccgttccacggcgtagcccatgtcggctacattccatcgaatggg
caggtggcgggcctcagcaagctggcccgactggtggagttgtacgcccggcgtccgcag
gtgcaggaacgcctcacccagcaggtcgccgatgcgctgatgaccggcatcgaggctcgc
ggcgtgatcgtggtcaccgaatgcgatcacatgtgcatggccatgcgaggcgtcaagaag
ccacagtcgcgtaccgtgacctccgccgtgcgaggctgcatgcgagatgccgccacaaga
tccgaggcgatgagcctgattctgtcacagcattcgtga

DBGET integrated database retrieval system