KEGG   Bifidobacterium dentium: BDP_0552Help
Entry
BDP_0552          CDS       T01143                                 

Definition
dihydroneopterin aldolase (EC:2.5.1.15)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
bde  Bifidobacterium dentium
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bde00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651203..652663
Genome map
AA seq 486 aa AA seqDB search
MDQIRLTGIRAAGKHGVLDFEHERAQTFVVDATLSLDLAPAGRSDALDDTVDYGAIAKGI
VAIIEGEHADLIERLAARIADMILQYPAVQRAEVTVHKPNAPIVVPFDDVSVTVERFRET
GRAESADTHHAIIAMGGNQGDVLSTLRDAVRCIDGLDSTQVTGISPLYRTDAWGMPTGTP
DFRNAVVSVNTKLTAPELLAGLQRIEASHGRVRTDHWTSRTLDLDIIDFDGIVSDDPDLT
LPHPRAWQRAFVLGPWLALDPDAELVGAHAGSVAQLLFESSDREHINELAEDWMVADDAA
ASPVTGSCHEEPASLQTGSGQHRIESLARSRRAVISMDSPSTDAERRFRKAIVSIDGIPG
NQVEGISPLYHVSQLDGKPDNMAAVMQISTRMGAAELITVLGSIETSVGGSLDLDLVDME
GVVSDEPNCQVPWPTARNHAAVLAPWLDMDPDARLGGDPVSFLLAMAPDTSQVGLLTDNW
IIGDTL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggatcagattcgactgacgggaattcgcgcggcgggtaagcatggcgtgcttgatttt
gagcatgaacgtgcgcagaccttcgtagtggacgccacgctgtcgctcgacttggcaccc
gcaggccgttccgacgcccttgacgacaccgtggattacggtgccatagccaaaggcatt
gtggccatcatcgaaggtgagcatgccgatctgatcgaaagactcgccgctcgcatcgcc
gacatgattctgcaatatcccgcggtgcaacgtgcggaagtgaccgtgcacaagccgaac
gcaccgatcgtcgtgccgttcgacgatgtcagcgtcaccgtggaacgcttccgtgaaacg
ggccgggccgaatccgccgacacgcatcatgccatcatcgccatgggaggcaatcagggt
gatgtgctctccacgctacgcgatgcggtgcgttgtatcgacggactcgactccactcag
gtcaccggcatttcgccgctatatcgcaccgacgcatggggcatgccaacgggaacaccc
gacttccgcaatgcggtcgtttccgtcaacaccaagctgaccgcacccgaactgttggcc
ggattgcaacgcatcgaagcctcccatggccgcgtgcgcaccgaccattggacttcgcgt
acgctcgaccttgacatcatcgacttcgacggcatcgtcagcgatgatccagatctgaca
ttgccgcatccacgtgcgtggcagcgtgccttcgtgctcggcccctggctggcattggat
cccgacgccgaactggtcggcgcgcatgccggatccgtggcacaactgctgttcgaatcc
tccgatcgggagcacatcaacgagctcgccgaagactggatggtcgccgatgacgccgct
gcgtctcccgttaccggttcctgccacgaggagccggcctctttacaaaccggaagcggt
caacatcggatcgaatccctagcacgatcccgtcgagccgtaatctccatggacagccct
tccaccgatgcagaacggcggttccgcaaggcgatcgtgtcgatcgacggcatccccggc
aatcaggtggaaggcatttcgccgctgtaccatgtcagccaacttgacggcaaacccgac
aacatggccgccgtcatgcagatttccacacgcatgggtgcagccgaactgatcacagtg
ctcggatccatcgaaacatcggtcggcggtagcctcgatctcgatctggtcgatatggaa
ggcgtcgtcagcgacgaaccgaattgccaggtgccgtggcccaccgcccgcaaccatgcg
gccgtactcgcgccgtggctcgacatggatccggacgccaggcttggcggagatccggtg
tcgttcctcctggccatggctccggatacgtcgcaggtcggtctgctcaccgacaactgg
attattggagatacgctatga

DBGET integrated database retrieval system