KEGG   Bifidobacterium dentium: BDP_0561Help
Entry
BDP_0561          CDS       T01143                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bde  Bifidobacterium dentium
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BDP_0561
   00051 Fructose and mannose metabolism
    BDP_0561
Enzymes [BR:bde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BDP_0561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
662132..663478
Genome map
AA seq 448 aa AA seqDB search
MGLWDIDKIPYVGREKGPQEGLAFHYYDADKVVAGKKMKDWLRFGVAWWHTFDQELVDPF
GTGTSQRPWYGKYSNAMDQSLAKVDYAFEFFQKLGVEYFCFHDRDIAPEGDTLRETDANL
DKIVDKIEENMKSTGVKLLWNTSSLFTNPRFVSGASTSPFADIYAYSGGQLKHSLEIAKR
LGAENYVFWGGREGYENLWNTQMKREQEHMAKFFHMCHEYAQEIGLDAQFLIEPKAKEPT
MHQYDFDASTAIAFLKTYDIDFMKLNLEGNHANLAGHTYQHEIRTAREAGVLGSLDANQG
DKLIGWDMDEFPTDLYETSTVMWEVLAAGQIGPHGGLNFDAKPRRTSFYAEDLFRSHIAG
MDSFAAGLLVAAKMHEDKFIENLQAERYSSYDSGIGATIEDGTATLASLEEYALDIPQAK
LIEATKSDHLESVKATINNYMVEALAEA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgtgggatatcgataagattccgtatgtcggtcgcgaaaagggaccgcaggaa
ggtctggctttccactactacgacgccgataaggtcgtcgccggcaagaagatgaaggat
tggctgcgcttcggcgtcgcttggtggcacaccttcgatcaggagctcgtcgatccgttc
ggcactggcacctcccagcgtccatggtacggcaagtactccaatgccatggatcagtcc
ctggccaaggtcgattacgccttcgagttcttccagaagctcggcgtcgaatacttctgc
ttccatgatcgcgacatcgctccggaaggcgacaccctgcgcgagaccgacgccaacctc
gacaagatcgtcgacaagatcgaggagaacatgaagtccaccggcgtcaagctgctgtgg
aacacctcctccctgttcaccaacccgcgtttcgtctccggcgcctccacctctccgttc
gccgacatctacgcatattccggtggccagctgaagcactccctcgagatcgccaagcgt
ctgggcgccgagaactatgtgttctggggcggccgcgaaggctatgagaacctgtggaac
acccagatgaagcgtgagcaggagcacatggccaagttcttccacatgtgccatgagtat
gctcaggagatcggcctggatgcccagttcctgatcgaaccgaaggccaaggagccgacg
atgcaccagtacgacttcgatgcatccaccgccatcgccttcctgaagacctacgacatc
gacttcatgaagctgaatctggaaggcaaccacgccaacctggccggccatacctaccag
cacgaaatccgtaccgcccgtgaagccggcgtgctcggctccctcgacgccaaccagggc
gacaagctcatcggctgggacatggatgagttcccgaccgacctgtacgagacctccacc
gtcatgtgggaagtcctcgccgctggtcagatcggccctcacggtggcctgaacttcgac
gccaagccgcgccgtacctccttctacgccgaggatctgttccgctcccacatcgctggt
atggattccttcgccgcaggcctcctggttgccgccaagatgcacgaggacaagttcatc
gagaacctgcaggccgagcgttacagctcctacgactccggaatcggcgcgaccatcgaa
gacggcaccgcgaccctggcttccctcgaagagtacgctctggacatcccgcaggccaag
ctcatcgaggccaccaagtccgatcatcttgagtccgtcaaggccacgatcaacaactac
atggtcgaggctctggccgaggcctga

DBGET integrated database retrieval system