KEGG   Bifidobacterium dentium: BDP_1090Help
Entry
BDP_1090          CDS       T01143                                 

Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bde  Bifidobacterium dentium
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BDP_1090
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BDP_1090
Enzymes [BR:bde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BDP_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1234504..1235466
Genome map
AA seq 320 aa AA seqDB search
MVGKSVITLDDLSIRQIQELLHKAQYIDSHRKEVAHTCEGRVLATLFYEPSTRTRLSFET
AMLRLGGKVIGFAGAQLASVTKGETIADTLKTVSNYVDVVAIRHPKEGAALVASRAASVP
VINAGDGGHMHPTQTLADLATLQSRFGRITNLTVGLCGDLTFGRTVHSLIETLCRFGNVN
FVLISPDELKTPRYVLDRIDATESCSYTEVKDLASVIGDLDVLYMTRVQKERFFNEDDYL
RLRDTYILDEAKMSLAKKDMAVLHPLPRVNEIAVEVDDDPRAAYFEQVKNGMLMRMALES
SVVGDKLPGYEPLESEEVAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcggaaaaagcgtcatcactcttgacgatctttccattcgtcagattcaggaactg
ctgcacaaggcgcagtacatcgattcccatcgcaaggaagtggcgcacacctgtgaaggc
agggtgcttgccactttgttttatgagccgagcacgcgtacccgactgagcttcgaaacc
gccatgttgcgactcggtggcaaggtgatcggttttgccggcgcccagctcgcctccgtg
accaagggcgagaccattgccgataccctgaagaccgtttccaattacgttgatgtggtc
gccatccgccatccgaaggagggcgccgcgctcgtggcttctcgcgcagcatccgtgccg
gtcatcaatgccggcgatggcgggcacatgcacccgacgcagacccttgccgacctagcc
accctgcagtcccgtttcggacgcatcaccaacctgaccgtcggattgtgcggcgatttg
acgttcgggcgcaccgtgcactccctgatcgaaacgctgtgccgcttcggtaacgtgaac
ttcgtacttatcagccctgacgagctcaagactccgcgttatgtgctcgaccgtatcgat
gccaccgaatcctgctcctacacggaggtcaaggacctggcttccgtaatcggcgacctt
gacgtgctgtatatgacccgtgtgcagaaggaacgcttcttcaacgaggatgactacctg
cgtctgcgtgatacctatattctcgacgaagccaagatgagcctcgccaagaaggacatg
gccgtgctgcatccgctgccgcgagtcaatgaaatcgcagttgaagtcgatgacgatccc
cgcgccgcctacttcgagcaggtcaagaacggcatgcttatgcgtatggcattggaaagc
tcggtggtcggcgacaaactgccgggatacgaaccgcttgaatcggaggaggttgcggcc
tga

DBGET integrated database retrieval system