KEGG   Bifidobacterium dentium: BDP_1109Help
Entry
BDP_1109          CDS       T01143                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.73)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bde  Bifidobacterium dentium
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BDP_1109 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDP_1109 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    BDP_1109 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BDP_1109 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BDP_1109 (adh)
   00626 Naphthalene degradation
    BDP_1109 (adh)
Enzymes [BR:bde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BDP_1109 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1253347..1254393
Genome map
AA seq 348 aa AA seqDB search
MKAAIYKGIKQMACEERPKPTIIDDGDAIIRVVRACVCGSDLWFYRDGREADTQTGHEAI
GVVESVGDDVTIAKPGDFVIVPFPYSCGKCPVCKAGFESSCPHGGYFGSGDGMGCQAEYL
RVPEADGTLVVVPADAEDLSDEMLASLLTLSDVMSTGYHAAASAEVKPGDTAVVFGDGAV
GLCAVLSAKLMGASRIISMSRHADRQGIARKFGATDFVEERGDEAVAKVLEMTDGYGADA
VLECVGSALSNDTAMKVARAGAVVGRVGLPHDVEVDIPGLFYRNVGLRGGPAPVRTYDMQ
RLLKEVLDGTINPGIVYTSEYTLDDIQEAYAAMDERRTVKSLLRISEV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcaatctataagggcatcaagcaaatggcatgcgaggaacgcccgaaaccg
acaatcatcgacgacggtgacgcaatcatccgcgtagttcgcgcctgcgtatgcggatcc
gacctgtggttctaccgtgatggacgtgaggccgacacgcagaccggtcatgaggccatc
ggcgtcgtcgaatccgtcggcgacgatgtcaccatcgccaagccgggcgatttcgtaatc
gtgccgttcccgtacagctgcggcaagtgcccggtatgcaaggccggctttgaatccagc
tgcccgcacggcggctacttcggcagcggcgatggcatgggatgccaggccgaatacctg
cgcgtgccggaagccgacggcactctcgtggtcgtgccggcagatgccgaggacctctcc
gacgagatgctcgcatcgttgctgaccctatccgacgtgatgtcgaccggttaccatgcg
gcagcctcggccgaagtcaagccgggcgacaccgcggttgtgttcggcgatggtgcggtc
ggcctgtgcgcggtactttccgccaagttgatgggagcctcccgcatcatctccatgagc
cgccatgccgatcgtcagggaatcgcccgcaagttcggcgccactgatttcgttgaggaa
cgcggcgacgaagccgtggccaaggtactggaaatgaccgacggttacggtgcggacgcc
gtgctcgaatgcgtgggttccgccttgtcgaacgacaccgccatgaaggtggcccgcgcc
ggcgcggtcgtcggccgtgtcggtctgccgcatgacgtcgaagtcgacattccaggcctc
ttctatcgcaacgtcggcctgcgcggaggtcctgcgccggtgcgcacctacgacatgcag
cgattgcttaaggaagtgcttgacggcaccatcaacccgggcatcgtctacaccagcgaa
tacacgctcgacgacatccaggaggcatacgccgccatggacgagcggcgtaccgtcaag
tcgctgctgcgtatcagcgaagtctga

DBGET integrated database retrieval system