KEGG   Bifidobacterium dentium: BDP_1117Help
Entry
BDP_1117          CDS       T01143                                 

Gene name
pncA
Definition
Pyrazinamidase/Nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bde  Bifidobacterium dentium
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BDP_1117 (pncA)
Enzymes [BR:bde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BDP_1117 (pncA)
    3.5.1.-  
     BDP_1117 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1261155..1261760
Genome map
AA seq 201 aa AA seqDB search
MAKALIVVDVQPTFCEGGELGVQGGNAVAERIADYVNAHRSEYAYIATTQDWHIEPGTHW
SEHPDFVDTWPVHGKAGTANAELHPAIAALNVKHHFKKGQYSPSYSGFEGFEDNTDRIPT
REEVSIAMAAGKTLANGLKTAGITRVDVVGLAESHCVKETALDAKKLGFEVHVIENLTEP
VSEELGIAARRQMSEADIILD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctttgatcgtggtggatgtgcagccgacgttctgcgaaggaggcgaactt
ggtgtgcagggaggcaatgcggtcgccgaacgtatcgcggattatgtgaacgcacatcgg
agcgagtacgcatatatcgcgaccacgcaggactggcatatcgagccggggactcactgg
tccgagcatcctgacttcgtggatacctggccggtgcatggcaaggccggaaccgccaat
gccgaactgcatcccgccatcgccgcattgaacgtcaagcatcatttcaagaaaggtcag
tattcgccatcatattccggcttcgaaggcttcgaggacaacaccgaccgcatccccacc
cgcgaagaagtctccatcgccatggccgcgggcaagacacttgccaacggattgaagact
gcaggcatcacacgggtcgatgtggtcggcctggccgaatcacactgcgtcaaagagacc
gctctcgacgcaaaaaagctggggttcgaagtgcatgtcatcgaaaacctgaccgaaccg
gtcagtgaggaactcggtatcgcagcccgtcggcaaatgagcgaagccgacatcatcctc
gactga

DBGET integrated database retrieval system