KEGG   Bifidobacterium dentium Bd1: BDP_1139Help
Entry
BDP_1139          CDS       T01143                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00010  Glycolysis / Gluconeogenesis
bde00051  Fructose and mannose metabolism
bde00562  Inositol phosphate metabolism
bde01100  Metabolic pathways
bde01110  Biosynthesis of secondary metabolites
bde01120  Microbial metabolism in diverse environments
bde01130  Biosynthesis of antibiotics
bde01200  Carbon metabolism
bde01230  Biosynthesis of amino acids
Module
bde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDP_1139
   00051 Fructose and mannose metabolism
    BDP_1139
   00562 Inositol phosphate metabolism
    BDP_1139
Enzymes [BR:bde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BDP_1139
Exosome [BR:bde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BDP_1139
  Exosomal proteins of bladder cancer cells
   BDP_1139
  Exosomal proteins of melanoma cells
   BDP_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADB09770
UniProt: D2QAD4
Position
1286291..1287085
Genome map
AA seq 264 aa AA seqDB search
MTSRRIPLVAGNWKMNFDHLEATYFVQQLAWKLRDVHFDHKRCEIALMPSFTSLRSVQVL
VESDNLKIRYGAQAVSVTSQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESYEERRKGIELDFAVGQVHDVTRDLSDEEASRLIVAYEPVWA
IGTGMVATPQSAQDAAKAIRDDLTATFSAAVGDTVRILYGGSVSSKNAVELIGEPDVDGF
LIGGAALKVDELTKICRLTLEATA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacggcgcattccgctggtcgcgggcaattggaaaatgaacttcgatcatctc
gaagccacctatttcgtacagcagttggcctggaaactgcgcgacgtgcatttcgaccat
aaacgctgtgaaatcgccttgatgccatccttcacttcattgcggagcgtgcaggtgctg
gtggaatccgacaacctgaagattcgttatggggcgcaggcggtgtccgttacgtcgcag
ggggcattcaccggcgacgtctccgcggatatgattgcgcatcttggatgttcgtatgtc
atcgtcggccattccgaacgccgcaaataccatccggaggatgatgcgaatatcgtcgat
caggtgcgtgcggtgctggcggccggcatgcagcccatcctgtgcgtgggcgaaagctat
gaggagcggcgtaagggcattgaactcgatttcgccgtcgggcaggtacatgacgttacg
cgtgatctttccgatgaggaagcctcccgactgattgtggcctatgagccggtctgggcc
atcggtaccggcatggttgccacgccgcaatccgcgcaggatgcggcgaaggccatccgg
gatgatcttacggcgacgttcagtgccgcggttggcgatacggtgcgcattctctacggc
ggatcggtgtcttccaagaatgcggtcgagctcatcggagaaccggatgtcgacggattc
ctcatcggcggcgccgcattgaaggtggatgagcttaccaaaatctgccgtttgactctc
gaagcgaccgcctag

DBGET integrated database retrieval system