KEGG   Bifidobacterium dentium: BDP_1139Help
Entry
BDP_1139          CDS       T01143                                 

Definition
triosephosphate isomerase (EC:2.7.2.3)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bde  Bifidobacterium dentium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDP_1139
   01230 Biosynthesis of amino acids
    BDP_1139
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDP_1139
   00051 Fructose and mannose metabolism
    BDP_1139
   00562 Inositol phosphate metabolism
    BDP_1139
Enzymes [BR:bde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BDP_1139
Exosome [BR:bde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BDP_1139
  Exosomal proteins of bladder cancer cells
   BDP_1139
  Exosomal proteins of melanoma cells
   BDP_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1286291..1287085
Genome map
AA seq 264 aa AA seqDB search
MTSRRIPLVAGNWKMNFDHLEATYFVQQLAWKLRDVHFDHKRCEIALMPSFTSLRSVQVL
VESDNLKIRYGAQAVSVTSQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESYEERRKGIELDFAVGQVHDVTRDLSDEEASRLIVAYEPVWA
IGTGMVATPQSAQDAAKAIRDDLTATFSAAVGDTVRILYGGSVSSKNAVELIGEPDVDGF
LIGGAALKVDELTKICRLTLEATA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacggcgcattccgctggtcgcgggcaattggaaaatgaacttcgatcatctc
gaagccacctatttcgtacagcagttggcctggaaactgcgcgacgtgcatttcgaccat
aaacgctgtgaaatcgccttgatgccatccttcacttcattgcggagcgtgcaggtgctg
gtggaatccgacaacctgaagattcgttatggggcgcaggcggtgtccgttacgtcgcag
ggggcattcaccggcgacgtctccgcggatatgattgcgcatcttggatgttcgtatgtc
atcgtcggccattccgaacgccgcaaataccatccggaggatgatgcgaatatcgtcgat
caggtgcgtgcggtgctggcggccggcatgcagcccatcctgtgcgtgggcgaaagctat
gaggagcggcgtaagggcattgaactcgatttcgccgtcgggcaggtacatgacgttacg
cgtgatctttccgatgaggaagcctcccgactgattgtggcctatgagccggtctgggcc
atcggtaccggcatggttgccacgccgcaatccgcgcaggatgcggcgaaggccatccgg
gatgatcttacggcgacgttcagtgccgcggttggcgatacggtgcgcattctctacggc
ggatcggtgtcttccaagaatgcggtcgagctcatcggagaaccggatgtcgacggattc
ctcatcggcggcgccgcattgaaggtggatgagcttaccaaaatctgccgtttgactctc
gaagcgaccgcctag

DBGET integrated database retrieval system