KEGG   Bifidobacterium dentium: BDP_1163Help
Entry
BDP_1163          CDS       T01143                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bde  Bifidobacterium dentium
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BDP_1163
   00052 Galactose metabolism
    BDP_1163
   00500 Starch and sucrose metabolism
    BDP_1163
   00520 Amino sugar and nucleotide sugar metabolism
    BDP_1163
Enzymes [BR:bde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BDP_1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1308698..1310128)
Genome map
AA seq 476 aa AA seqDB search
MTEDIFEQSAAKMREHGMTDMAIAQFKRLYEVWRNEEASSWIREEEVEPLTGVPSFHDVY
ETINHDKAVDAFAQTAFLKLNGGLGTSMGLDCAKSLLPVRRHKARQMRFIDIIIGQVLTA
RTRLGVELPLTLMNSFRTSDDTMKVLRSNKKFHQDEIPMEIIQHQEPKISAKTGLPASFP
SNPELEWCPPGHGDLFSTVWESGLLDRLEERGFKYLFISNSDNLGARPSRTLAQHFENTG
APFMIEVAKRTPADRKGGHIVRDKVTGRLMLREMSQVHPDDKDDAQNIDKHPYFNTNSIW
VRIDALKAKLAAYDGVLPLPVIRNKKTVDPTDSTSEPVIQLETAMGAAVTLFDGATCVCV
DRMRFLPVKTTDDLFIMRSDRFHLTDQYEMEDGNYIFPTVHLDARYYKNIHDFDTRFPYS
VPSLAAANSVTIEGDWTFGRDVMMFGDARLSDQDEPSYVPNGEYVGPQGVEPDDWV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaggacatattcgaacagtccgccgcaaagatgcgtgagcacggaatgacagat
atggccattgcccagttcaaacgcctatacgaggtctggcggaacgaggaggccagcagt
tggattcgtgaggaagaggtcgagccacttaccggcgtgccaagtttccatgatgtgtac
gagaccatcaaccatgacaaggcggtcgacgccttcgcacagaccgctttcctgaagctg
aacggcggtcttggcacctccatgggcctggattgcgccaagtcgttattgcccgtacgc
cgccataaggcgcgccagatgcgtttcatcgacatcatcatcggtcaggtgcttaccgcc
cgcactcgtctgggcgtagaacttccgctcaccctgatgaattccttccgtacgtccgac
gacaccatgaaggtgctgcgttccaacaaaaaattccatcaggacgagattccgatggaa
atcatccaacatcaggagccgaagatcagtgccaaaaccggcttgccggcttccttcccc
tcgaatcccgaactcgagtggtgcccgccggggcatggagacctgttctccaccgtttgg
gagtccggcctgctcgacaggcttgaggagcggggcttcaagtatctgttcatttccaac
tccgacaatctgggtgcgcgaccgtcccgtacgctcgcccaacacttcgagaacacgggc
gcaccattcatgatcgaggttgccaaacgcacgccggctgaccgcaagggcggccatatc
gtacgcgataaggtgaccggacgtctcatgttgcgcgagatgagccaagtgcatcctgac
gacaaggatgacgcccagaacatcgacaagcatccgtacttcaacaccaacagcatctgg
gtgcgcatcgatgcgttgaaagccaagcttgccgcgtacgatggcgtattgcctctgccg
gtgattcgcaacaagaagaccgttgatcccaccgattcgaccagcgagccggtcattcag
ctggaaacggccatgggtgcggccgtcacgctattcgacggcgcaacctgcgtatgcgtg
gaccgtatgcgcttcctgccggtcaagaccacggatgatctgttcatcatgcgttccgat
cgtttccatctgaccgatcagtatgagatggaggatggcaactacattttccccacggtg
catctcgacgcacgctattacaagaacatccatgatttcgacacgcggttcccgtattcc
gtgccgtcgcttgccgccgccaattcggtaaccatcgagggggactggacgttcggcagg
gatgtcatgatgttcggcgacgcgcggctctccgatcaggatgagccaagttatgtgcca
aacggtgaatacgttgggccgcaaggcgttgagccggatgattgggtctga

DBGET integrated database retrieval system