KEGG   Bifidobacterium dentium Bd1: BDP_1176Help
Entry
BDP_1176          CDS       T01143                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase ruvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BDP_1176 (ruvA)
Enzymes [BR:bde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BDP_1176 (ruvA)
DNA repair and recombination proteins [BR:bde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BDP_1176 (ruvA)
    RecFOR pathway proteins
     BDP_1176 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1322792..1323298)
Genome map
AA seq 168 aa AA seqDB search
MHAGQEVKVYTSLNVSQDAITLFGFLTPASKRMFLQLQKVSGIGPKVALSLLSTLPPDRL
AHAVADGDATALAKAPGLGKKGAQKIILELKGSIDLSQIETAASVISRPEDTGSEQVVEG
LISLGWRQQDALHAVQEVCRSNDIATPLSNEDVPRVLKLALTSLDRGR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcggggcaggaagtcaaggtctatacttcgttaaacgtttcgcaggatgccatc
accctgttcggctttctgactcccgcttcgaaacgcatgtttctacagctgcagaaggtc
agcggcatcggccccaaagtggcgctttccctgctgtccacgctgcctccggatcgtttg
gcccatgccgtcgccgacggcgatgccaccgcgcttgccaaggcgccgggactcggcaag
aaaggcgcacagaagatcattctcgagcttaagggttccatcgatctcagccagatcgag
acggcggcgtccgttatcagtcggccggaggacactggttccgaacaggtggtcgagggg
ctgatttcattgggctggcgtcagcaagacgccctgcatgccgtgcaggaggtatgcagg
agcaacgacatcgcaacacccctgagcaatgaagatgtaccacgtgtgttgaagctcgca
ttgacgtcgctggatcgaggtaggtga

DBGET integrated database retrieval system