KEGG   Bifidobacterium dentium: BDP_1191Help
Entry
BDP_1191          CDS       T01143                                 

Gene name
trpA
Definition
(GenBank) TrpA Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bde  Bifidobacterium dentium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BDP_1191 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDP_1191 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BDP_1191 (trpA)
Enzymes [BR:bde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BDP_1191 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1335754..1336632)
Genome map
AA seq 292 aa AA seqDB search
MTNATAATTPSGQPLGISHRPSPTEAMFDAFKASDEPAFIGYLPYGFPNPDYSLKAFKTM
VEHGVDAVEIGLPYSDPVMDGPVIQAASQIAIDNGETIANVFKAVETVANAGGVPLVMSY
WNLIFHYGVERFARDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRVFLVSPDSTADR
LKVVADNARGFVYAAARMGVTGERATIDASPQELVARTREAGAKNVCVGIGVSTAEQGAC
VGSYADGVIVGSALVHTMLDESGKVAVDETTGLKALAAKAEELAEGIHNARH
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgcaaccgccgcaaccaccccgtccggccagccgttgggcatcagccacagg
ccaagcccgaccgaagccatgttcgatgcgttcaaggccagcgacgaaccggcgttcatc
ggttaccttccatatggattcccgaacccggattactcgcttaaggcattcaagaccatg
gtcgagcatggcgtcgatgccgtggaaatcggtttgccgtattccgatcccgtgatggat
ggcccagtcatccaggccgcctcccagatcgccatcgacaacggcgaaacaatcgccaac
gtgttcaaggctgtggagaccgtagccaatgccgggggagtgcctctggtcatgagctat
tggaacctgatcttccactacggcgtcgaacgctttgcacgcgattttgaaaacgccggc
ggtgccggattgatcacgccggacctcatccccgatgaagccggcgaatggatcgaggcc
tccgatcgccacggtcttgaccgcgtcttcctggtatccccggactcgaccgccgaccgt
ctgaaggtcgtggccgacaacgcccgtggattcgtctatgccgcagcccgcatgggtgtg
accggcgaacgtgccaccatcgatgcctcacctcaggaattggtggcacgcactcgtgaa
gcgggcgcgaagaacgtgtgcgtcggcatcggcgtttccaccgccgaacagggggcgtgt
gtcggctcctatgcagatggcgtcatcgtcggttccgccttggtgcacaccatgctcgac
gaatccggcaaggtcgccgtcgacgagacgacgggcctcaaggcccttgcagccaaggcc
gaggaacttgccgaaggcatccacaacgcccgccactga

DBGET integrated database retrieval system