KEGG   Bifidobacterium dentium Bd1: BDP_1192Help
Entry
BDP_1192          CDS       T01143                                 

Gene name
trpBC
Definition
(GenBank) TrpB/TrpC bifunctional protein, includes tryptophan synthase beta chain and indole-3-glycerol phosphate synthase
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BDP_1192 (trpBC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDP_1192 (trpBC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BDP_1192 (trpBC)
Enzymes [BR:bde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BDP_1192 (trpBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1336652..1338724)
Genome map
AA seq 690 aa AA seqDB search
MAGAVEDQQAREKSVSLDELKRQVAQAPAPIDARRWLKKADGIPVIAEIKRASPSKGHLS
DIPDPSALAREYERGGASAISVLTEGRRFLGSLDDLDKVRAAVHIPVLRKDFIVTEYQIW
EARAHGADLVLLIVAALDDAKLRSLLDLAHTLDMTVLVETHTREEIQRAIAAGARVIGIN
ARNLKDLKVDVNKYDELAADLPDDVIRVAESGVFGAVELEDYARAGADAVLVGEGVATAA
NHEQAVERLVKAGARVKASEQTPLSTHEGPYFGQFGGRYVPEALITALDELERVYAQAKA
DPEFHKELARLNQQYVGRPSPLTEAPRFAERLREKTGLDARVFLKREDLNHTGAHKINNA
LGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQALNVARMRM
LGAEVVEVTLGDRILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDFQKIIGEE
AKQQLQDWYGIDHPDAICACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPESGRHAIR
FAPGTGELGMFQGAKSYLLENAEGQTLDTYSISAGLDYASVGPEHAWLKDIGRVNYSWAT
DEEAMSGFKDLCETEGIIPAIESSHAVAGAYKAAEDLKAKGYEHPVMIINISGRGDKDMN
TAGKWFGYLTDEQAKALEANGAQGNNADGE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggagccgtcgaagaccaacaggcacgtgagaagagcgtgtcgctcgacgaattg
aagcggcaggtggcccaggctcctgcgccgatcgatgcgcgccgatggttgaagaaagcg
gatggcattccggtcattgccgaaatcaagagggcctcgccttccaagggccacctcagc
gatatccccgatccgtcggcgttggcccgggagtatgagcgcggtggggcaagcgcgatt
tccgtacttaccgagggacgtcgtttccttggctcgcttgatgatttggacaaggtccgc
gctgccgtgcatattccggtgctccgtaaggatttcatcgtcaccgaatatcagatctgg
gaggcacgcgcccatggcgccgatctggtgttgctcatcgtcgcggcattggatgatgcc
aagctcaggtcgttgctcgatctggcccacaccctcgatatgacggtgctggtcgagacg
cacacgcgcgaggagattcaacgcgccattgccgcaggtgcacgtgtgatcggcatcaat
gcacgtaacctcaaggatctgaaagtggacgtcaataaatacgacgagctcgcagccgac
ctacccgacgatgtcatcagggttgccgaatcaggtgtattcggagccgtcgagcttgaa
gactatgcccgcgccggagccgatgcagtgctcgtaggtgagggcgtcgccaccgcagcc
aatcatgaacaggccgtcgaacgtctagtaaaggcaggagcaagagtgaaagcatccgaa
caaaccccgttgagcacacatgaaggtccatatttcggccaattcggtggacgctacgtg
ccggaggcgctgattacggcgcttgacgagctcgaacgcgtctacgcacaggccaaggcc
gatccggaattccacaaggaacttgccaggctcaaccagcagtacgtgggccgtccgtcg
ccactgaccgaagctcctcgttttgccgagcgccttagggagaaaaccggtttggacgcc
cgggtcttcctcaagcgcgaggatctgaaccacaccggcgcacacaagatcaacaatgcc
ctcggacaggcgctgctggtcaagcgcatgggcaagacccgcgtcatcgccgaaaccggt
gcgggtcagcatggtgtggccactgccaccgtatgcgccatgctcggtctgaagtgccgt
atctacatgggtcagatcgatgcccgccgtcaggctttgaatgtggcccgcatgcgcatg
ctcggagccgaagtcgtggaagtcacgttgggcgaccgtattctcaaggatgccatcaat
gaggcgctgcgcgactgggtcaccaacgtcaaggacacgcattatctgctcggcaccgtt
gcaggaccacaccccttccccgccatggtgcgtgatttccagaagatcatcggcgaagag
gccaagcagcagttgcaggattggtacggcatcgatcatccggacgccatctgcgcctgc
gtcggtggcggttccaatgccatcggcgtcatgaatgccttcctcgatgacgaacgtgtg
aacctatacggttatgaagctggcggtaacggtcccgaatccggacgccacgccattcgt
ttcgctcccggaaccggtgagctgggcatgttccagggtgcaaagagctacctgctcgaa
aacgccgaaggccagacgctcgatacctactctatttccgcgggcctcgattacgcgtcc
gtgggaccggaacatgcatggctcaaggatatcggccgcgtcaactattcgtgggccacc
gatgaggaagccatgagcggtttcaaggatctgtgcgagaccgagggcatcatccccgcc
atcgaaagctctcatgccgtcgccggcgcgtacaaggccgccgaggatctcaaagccaag
ggatatgagcatccggtgatgatcatcaacatctccggtcgaggcgacaaggacatgaat
accgcaggcaagtggttcggttatctgaccgatgagcaggccaaggcgctggaagccaat
ggcgctcaaggcaacaatgcagacggcgagtga

DBGET integrated database retrieval system