KEGG   Bifidobacterium dentium: BDP_1223Help
Entry
BDP_1223          CDS       T01143                                 

Definition
phosphoglycerate mutase family protein (EC:3.1.3.73)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bde  Bifidobacterium dentium
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDP_1223
   01230 Biosynthesis of amino acids
    BDP_1223
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDP_1223
  Energy metabolism
   00680 Methane metabolism
    BDP_1223
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDP_1223
Enzymes [BR:bde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BDP_1223
Exosome [BR:bde04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BDP_1223
  Exosomal proteins of melanoma cells
   BDP_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1370000..1370827)
Genome map
AA seq 275 aa AA seqDB search
MIDEVLFLRHGRTAYNLGRRLQGQIDIPLDIVGRWQVDQSAYELARRYYWAKITNQAQHP
ETLQQPTGPDAHLADPNEITQAPASKRQMTIISSDLFRAQQTARAFANLLGLPVEYDSRL
RERSFGEWEGMTREEIREANAPDYDSWRSHTGGELNHGVESRTHTGQRGSRAVLDILDRH
RENIVPTTLLIVGHGSWIVATIETLLGMDPDSLNNLGSMRNAFWSRMTPAGDAERPRWTL
DEFNQGPAIAAFTDWENGPDDLREPNMPQWKPIMQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgaagtactgttcctacgccacggaagaaccgcctacaaccttggcagaaga
ctgcaaggccaaatcgacatccccctcgacatcgtcggccgatggcaggtggaccaaagc
gcctacgaacttgcccgccgatactactgggcgaaaatcaccaatcaggcacagcatccc
gaaaccctgcaacaaccaaccggaccggacgcgcatctcgccgacccgaacgaaatcaca
caagcgccggcatcgaaacgccagatgaccatcatctcctccgacctgttccgcgcacaa
cagaccgcgcgcgccttcgccaacctgctcggcctgcccgtcgaatacgactccaggcta
cgcgaacgcagtttcggcgagtgggaaggcatgacccgtgaggaaatacgagaagccaac
gccccggactacgactcatggcgctcacataccggcggagaactcaaccatggcgtggaa
agccgcacccacaccggacaacgaggaagccgggcggtgctcgacattcttgaccgacac
cgcgaaaacatcgtgccgaccacactgcttatcgtcggccacggatcctggatcgtcgcc
accatcgaaacactgctcggcatggaccccgacagtctcaacaaccttggctccatgcgc
aacgccttctggtcacgcatgacgcctgccggcgatgcggaacgaccccgatggacactt
gacgaattcaaccaaggtccggccattgcagcattcaccgactgggagaacggacccgac
gacctcagagaaccgaacatgccgcaatggaaaccgatcatgcagtaa

DBGET integrated database retrieval system