KEGG   Bifidobacterium dentium Bd1: BDP_1229Help
Entry
BDP_1229          CDS       T01143                                 

Definition
(GenBank) Phosphoglycerate mutase family protein
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
bde  Bifidobacterium dentium Bd1
Brite
Enzymes [BR:bde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     BDP_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1377675..1378421)
Genome map
AA seq 248 aa AA seqDB search
MPRNVTIESRGNVPQHVHAITLVRHGRTAFNAQHRLQGQINIPLDEVGEWQVRQTARALR
ELYVDHRPDIPNRLVVCSDLDRAAATAHAFADPLGLTVHADERVRERSFGDWEGVAVEEL
AERYPEDYRSWAEFRGGELKYGAESKEHVGKRGVEALNDWAMRAGTDTDLFVFSHGAWIS
QTLQTLLGLNEVQPDFASILSMRNAHWVHLVPIEIGDTLRWRLLDYNHGPAIADTEQWEH
PRRQGLDF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcaacgtaacgattgaatcacggggcaatgtgccacagcatgtgcacgccatc
acgctggtacgtcatggacgtaccgcattcaatgcgcagcatcgcctgcaggggcagatc
aacattccccttgacgaagtgggcgagtggcaggtgaggcagaccgcaagggccttacgt
gagctttatgtggatcatcgtccggatattcccaatcgactggtggtctgctccgatctc
gaccgtgcggccgccaccgcacatgcctttgccgatccgctgggacttacggtgcatgcc
gatgagcgtgtgcgcgaacgcagcttcggtgattgggagggcgtcgccgtggaagagctc
gccgaacgttacccggaggattatcgttcctgggccgagttccgtggcggagaactcaaa
tatggcgcggaaagcaaggaacacgtcggcaaacgcggcgtggaagccctcaatgattgg
gccatgcgagccggaaccgacaccgacctattcgtgttctcccacggcgcctggatctca
cagacactgcagacgttgttgggactgaacgaagtacagcccgatttcgcctccattctt
tcgatgcgcaacgcacattgggtgcatcttgtaccgatcgaaataggggacacactgcga
tggagattgctagattacaatcacggtccggcaatcgccgataccgaacagtgggaacat
ccacgccgccaaggccttgacttttaa

DBGET integrated database retrieval system