KEGG   Bifidobacterium dentium: BDP_1265Help
Entry
BDP_1265          CDS       T01143                                 

Gene name
thrC
Definition
(RefSeq) thrC Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bde  Bifidobacterium dentium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BDP_1265 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDP_1265 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BDP_1265 (thrC)
Enzymes [BR:bde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BDP_1265 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1420471..1421958
Genome map
AA seq 495 aa AA seqDB search
MTTFHSTRSTTDSLTSKQAIRKGIADDGGLFVTDSLGETHVDIASLAGKSYQQIAFDVLS
VLLPDFTEDELKECITEAYGPQWSDGRITPVKPLGDDFVMELFNGPTSAFKDVALQILPR
FMARTTPADDDSHEKIMIVTATSGDTGKAALAGFADAAGTGITVFYPEGKVSQVQELQMT
TQTGSNVNVCAVKGNFDDAQSAVKRIFGDKELAERLADDSHVALSSANSINVGRLVPQVV
YYFSAYAQLLEQQVINVGDEVEFVVPTGNFGDILAGYYAKLLGLPVKHLVVASDRNNVLF
DFLTSGTYNRQRPFFQTISPSMDILISSNLERMLYYMSDKDTRLIAMLMNDLNQWGAYEV
PEPMLAKIRSIFGTGWADEDQVREMIADCWNKNHYVIDPHTACGYYVMQQMPRDPLTPRV
LLSTASPYKFPRVVNESLGLDASGTDFECMDVLAKATGTTAPAALRGLEHADVRFDDVVE
IDGMEHFVEQAAKSL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgttccacagcacacgcagtaccaccgactcgctcacctccaagcaggccatt
cgcaagggcatagccgatgacggcggcctgttcgtcaccgactccctgggcgaaacccat
gtggacatcgcgtccctggccggcaagtcctaccagcagatcgcgtttgacgtgttgtcc
gtactgttgccggatttcaccgaggacgaattgaaggaatgcattacggaggcgtacggg
ccgcagtggtccgatgggagaatcactccggtcaagccgctcggcgacgatttcgtgatg
gagctgttcaacggaccgacctccgcgttcaaggatgtggccctgcagatcctgccgcgc
ttcatggcacgcaccactccggccgacgatgatagccacgagaagatcatgatcgtcacc
gccacctccggagacaccggcaaggcggccctcgccggcttcgccgatgcggcgggcact
ggcatcaccgtgttctatccggaaggcaaagtcagccaggtgcaggagctgcagatgacc
acgcagaccggttccaacgtgaacgtgtgtgcggtcaagggcaatttcgatgatgcgcag
tccgcagtcaaacgcatcttcggagacaaggagcttgcggaacgtctggccgacgattcc
catgtggcactctcctccgcgaactccatcaacgtgggtcgtctggtgccgcaggtcgtc
tattacttctccgcttatgcgcagttgctggagcagcaggtgatcaatgtgggcgacgaa
gtcgagttcgtggtaccgaccggcaacttcggtgacattctcgccggctactacgccaaa
ctgctgggcttgccggtcaagcatctggtagtcgcctcagacaggaacaacgtgttgttc
gacttcctgacctccggcacatacaatcgtcagcgtccgttcttccagaccatctccccc
tcgatggacatcctcatctcctcgaatctggaacgcatgctgtactacatgtccgacaag
gacacccgtctgatcgccatgctgatgaacgatctcaaccagtggggagcctatgaggtc
cccgaaccgatgctcgccaagattcgttcgattttcggcaccggttgggccgacgaagac
caggtgcgcgagatgatcgccgactgctggaacaagaaccactacgtgattgacccgcac
accgcctgcggctattacgtgatgcagcagatgccgcgcgatccgctcaccccgcgtgta
ctgctttccacggccagcccgtataagttcccgcgcgtagtcaacgaatccctcggcttg
gatgcgtccggcaccgatttcgaatgcatggacgtgctcgccaaggccaccggcaccact
gctccagccgcactgcgcggccttgaacacgctgatgtacgtttcgatgatgtcgtcgag
attgacggtatggagcatttcgtcgagcaggccgccaaatcgttgtaa

DBGET integrated database retrieval system