KEGG   Bifidobacterium dentium Bd1: BDP_1336Help
Entry
BDP_1336          CDS       T01143                                 

Definition
(GenBank) Polyphosphate glucokinase/Transcriptional regulator
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00010  Glycolysis / Gluconeogenesis
bde00520  Amino sugar and nucleotide sugar metabolism
bde01100  Metabolic pathways
bde01110  Biosynthesis of secondary metabolites
bde01120  Microbial metabolism in diverse environments
bde01130  Biosynthesis of antibiotics
bde01200  Carbon metabolism
Module
bde_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDP_1336
   00520 Amino sugar and nucleotide sugar metabolism
    BDP_1336
Enzymes [BR:bde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BDP_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADB09949
UniProt: D2QAW3
Position
complement(1501161..1501928)
Genome map
AA seq 255 aa AA seqDB search
MIETAQAFGVDIGGSGIKAAPVNLEKGEFAEPRLKILTPEVSTPKAVGEIVRQQLEHFEV
PETAPVGIAFPAPIHVGEKLGYMANLDQSWVGVDVTEVFSEACGRPVTVVNDADAAGLAE
QQFGAAKGQNGLVVATTLGTGIGTALIFNGELIPNTELGHLELLKGKGDAEKYAASSVRE
KLDMGYKKWAKRLTKYYSLMEFYLDPQLFVVGGGVSRVSEKFLPYIDIKTPIVAAKLHNE
AGIIGAAYYASTKMK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattgagactgcacaagccttcggcgttgacatcggcggctccggcattaaggccgcc
ccggttaacctggagaagggcgaatttgctgagcctcgtctgaagattcttactccggag
gtgtccactccgaaggccgtcggtgaaatcgttcgccagcagctcgagcattttgaggtt
ccggagaccgctccggtcggcatcgctttcccggctccgattcatgtgggagagaagctc
ggctacatggccaatctggatcagtcttgggttggcgtggacgtcaccgaggtattctcc
gaggcatgcggtcgtccggtcaccgtggtgaacgacgccgacgccgcgggccttgccgaa
cagcagttcggcgccgccaaggggcagaacggcctggtcgtggccaccactttgggtacc
ggcatcggcaccgccctgattttcaacggtgaactcatcccgaacacggagctcggccat
ctggaactgctcaagggcaagggcgatgccgagaagtacgccgcctcatccgtccgtgag
aagctcgacatgggctacaagaagtgggccaagcgtctgaccaagtactactccctcatg
gagttctatctggatccgcagctgttcgtcgtcggcggcggtgtgtcccgcgtgtccgag
aagttcctgccgtacatcgacatcaagaccccgatcgtcgcggccaagctgcacaacgag
gccggcatcatcggcgctgcgtactatgcaagcaccaagatgaagtga

DBGET integrated database retrieval system