KEGG   Bifidobacterium dentium: BDP_1512Help
Entry
BDP_1512          CDS       T01143                                 

Gene name
purF
Definition
amidophosphoribosyltransferase (EC:2.4.2.14)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bde  Bifidobacterium dentium
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BDP_1512 (purF)
Enzymes [BR:bde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BDP_1512 (purF)
Peptidases [BR:bde01002]
 Cysteine Peptidases
  Family C44
   BDP_1512 (purF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1690778..1692538)
Genome map
AA seq 586 aa AA seqDB search
MALGHRRLSIIDLGGGQQPIYNEDGSLVITFNGEIYNYQPLRDELIAAGHAFTTKSDTEV
LLHGYEQWGVDLLQRVRGMFTFVIWDKNRRELFGARDHFGIKPFYYAKMNGTFMYASEIK
SLLQHPDFVKELNAEALKPYMTFQYPAIGETFFKGVYKLPEGHYFVYRDGEMSIHRYYDE
NFRESDQKLGELVNTIDDTVCGSVKAHQIADVEVGSFLSSGVDSSYVAAVARPEHTYSIG
FGKGTYNESQQAGELAELLKLNNTAEALTDEEAFAAFPRIQWHLDEPDSNPSCVPLYFLS
ALAAKDVKVVLSGEGADELFAGYIDYGVHTKYKPVKMLTRWLTHMPAGVRHAIARFCKGK
TFPGAWHLYANLAPAEESFIGQARVFEEAQSERLLKPEYRKAPSVQSIVDKTYARVKGKG
LSELKKKQYLDMHQWMPGDILLKADKMTMAHSLELRVPLLDKELMSVAEQVPTKYLINDE
NTKFAFRQAAGRHLPKEWYDREKLGFPVPIKKWLREEKFYKYVRSVFERDYVGLFFDQAA
LLKMIDDNYAGKTDDRRKIWTVYSFLTWYDVYFVHDGTKPEVIAID
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtggctctgggccatcgtcgcctgagcatcatcgatctgggcggaggccagcagccgatc
tacaatgaggacggttcgctggtcatcaccttcaacggcgaaatctacaattaccagccg
ttgcgcgacgaactgatcgccgcgggccacgccttcaccaccaaaagcgacaccgaggtg
ctgctccatggctatgagcagtggggcgtcgatctgctgcaacgcgtccggggcatgttc
accttcgtgatctgggacaagaacaggcgcgaactgttcggcgcccgcgaccacttcggc
atcaagcccttctactatgccaagatgaacggcacgttcatgtatgcctcggagattaaa
agcctcctgcagcacccggacttcgtcaaagagctcaacgccgaggcgctgaagccatac
atgaccttccagtacccggcaatcggcgagaccttcttcaaaggcgtgtacaagctgccg
gagggccattacttcgtctatcgcgacggcgagatgagcattcatcggtactatgacgag
aatttccgggaaagcgaccagaagctgggcgaactggtgaataccatcgacgatacggta
tgcggttccgtcaaagcccatcagattgccgacgtggaggtgggatccttcctgtccagc
ggcgtggactccagctatgtcgcagccgtggcccgccctgaacacacctattccatcgga
ttcggcaagggcacctacaacgaatcgcagcaggccggtgagctggccgaactgctcaaa
ctgaacaacaccgccgaggcgctgaccgacgaagaggcattcgccgcgttcccgcgcatc
caatggcatctggacgagccggattccaatccgagctgcgtgccgctgtacttcctgtcg
gctctggccgccaaggacgtcaaggtcgtattgagcggcgaaggcgccgatgagctgttc
gcgggctacatcgattacggcgtgcataccaaatacaagcccgtcaagatgctgacccgc
tggttgactcacatgccggcaggcgtgcgtcatgcgatcgcgcgtttctgcaaaggcaag
accttcccgggtgcgtggcatctgtatgcgaacctcgccccggccgaggaaagcttcatc
ggccaggcgcgtgtcttcgaggaggcgcagtccgaacggctgctcaagcccgaataccgt
aaggctccgagcgtgcaaagcatcgtggacaagacctatgcccgcgtgaagggcaagggg
ttgagcgagctcaagaagaagcagtacctcgacatgcatcagtggatgcccggcgacatc
ctgctcaaggccgacaagatgaccatggcccattcgctcgagttgcgcgtgccgctgctc
gacaaggagctgatgagcgtggccgaacaggtgcccaccaagtacctgatcaatgacgag
aacacgaagttcgcgttccgtcaggccgcgggacgtcacctgcccaaggaatggtatgac
cgcgagaagctcggcttcccggtgccaatcaaaaaatggttgcgcgaagaaaagttctac
aagtacgtacgttccgtgttcgaacgcgactatgtcggcctgttcttcgatcaggccgcc
ctgctgaagatgatcgacgacaattacgccggcaagacggacgatcgtcgcaagatctgg
acggtatactccttcctgacctggtacgacgtgtacttcgtgcatgacggcaccaagccg
gaagtcatcgccatcgactga

DBGET integrated database retrieval system