KEGG   Bifidobacterium dentium: BDP_1521Help
Entry
BDP_1521          CDS       T01143                                 

Gene name
mur
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bde  Bifidobacterium dentium
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BDP_1521 (mur)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BDP_1521 (mur)
Enzymes [BR:bde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BDP_1521 (mur)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1698977..1700524
Genome map
AA seq 515 aa AA seqDB search
MSLSLADGVHLLSSHHLLDEVITPERWSLNADGTDNADVPFTHITYDTRTVREGTLLVCK
GRFRPEFLDGLKERGLVAYVSERDFSDHTEVPGLIVNDARKALSLLSAAFYGMPQNELTV
IGITGTKGKTTTAYFTQAILNAYSNGRCALFSSVDNCLDGHTYVESELTTPESLDAFRMM
REAADNGMRYLVMEVSSQAYKVNRVHGLTFDVGAFLNISPDHISDIEHPTFEDYLYCKRQ
LAYHARAFVLNADADHADLIREDAQAAGIPLADFALRTDDAPTNATLTARPSNAEHSAFS
IAANGHDLGEFSLSLAGDFNYANALAAVALAHEAGVPFDSAAMHAMESVHVPGRMELFTG
TDGDTVAIVDYAHNYTSVRALIDFVEQRYGERKPRITLVAGSAGNKAFDRRQEIVEAAQD
RIARFVFTAEDTDTEPYIDICNEMLGHVTNDHVDATVIVDRVKAIESAVEQAHSHDGLDV
ILIIGKGHERWIKDLNSHVAYEGDDCVVERLLNVA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgtcccttgccgacggcgtgcatctgctgtcctcccatcatctgctcgatgag
gtcatcacacctgaacgttggagcctgaatgccgatggcaccgacaatgccgatgtgccg
ttcacgcatatcacctatgacacccgcaccgtgcgcgaaggcacgctgctggtgtgcaag
ggccgcttccggccggaattccttgacgggctcaaggagcgcggtctcgtcgcctatgtg
tcggaacgtgacttctccgatcacaccgaggttccgggactcatcgtcaacgacgcgcgc
aaggccctgagcctgctgtccgccgccttctacggcatgccccagaacgaactcacggtc
atcggcatcaccggcaccaaaggcaagaccaccaccgcatactttacgcaggccatcctc
aacgcctattccaacggtcgttgcgcattgttctcctcggtcgataactgtctcgacggc
catacctacgtggaatccgaactgaccacgccggagtcgttggacgcgttccgcatgatg
cgcgaggccgcggacaacggcatgcgatacctggtgatggaggtctcctcccaagcctac
aaggtcaaccgcgtccacggcctgaccttcgacgtgggagccttcctcaacatctccccc
gaccacatcagcgacatcgaacaccccaccttcgaagactatctgtattgcaaacgtcag
ttggcataccatgcacgcgccttcgtactcaacgccgacgccgaccatgccgatctcatt
cgcgaggatgcgcaggccgcgggcatcccgcttgcggatttcgccctgcgcaccgatgac
gcacctacgaatgcgacgctgacggcccgtccgtcgaacgccgaacacagcgcgttcagc
atcgccgcgaacggtcatgatctgggcgagttcagcctgtcattggctggcgatttcaac
tatgcgaacgccctcgccgccgtcgcactggcgcatgaggccggtgtgccattcgattcg
gccgccatgcatgccatggaatcggtgcatgtaccgggacgtatggaactgttcaccggc
acggatggcgacaccgtggccatcgtcgattatgcgcacaactacaccagcgtacgtgcg
ctgatcgatttcgtcgaacagcgctacggcgagcgcaagccgcggattacgctcgtcgcc
ggttccgccggcaacaaggcgttcgaccgccgtcaggaaatcgtcgaggccgcacaggat
cgcatcgcgcgtttcgtattcaccgccgaagacaccgataccgaaccgtatatcgacatc
tgcaacgaaatgctcggccatgtcaccaacgaccatgtggatgccacggtgatcgtcgat
cgtgtgaaggccatcgagagcgccgtcgagcaggcgcattcccacgatggtctcgacgtg
atcctcatcatcggcaagggccacgagcgttggatcaaggacctcaacagccacgtggcc
tacgaaggtgatgattgtgtggtggaacgactgctgaacgtggcgtag

DBGET integrated database retrieval system