KEGG   Bifidobacterium dentium: BDP_1583Help
Entry
BDP_1583          CDS       T01143                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bde  Bifidobacterium dentium
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bde01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bde00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1774082..1775464)
Genome map
AA seq 460 aa AA seqDB search
MRIIDLRGRKLTRAEMLDAMPRAEMGTNEATELVQPILDDVKARGAAALRDFAEKFDHIR
PENLRVPVEVMKAAVDELDPEVRAAIEESVRRSRAVSASQVPAPFHTDLAEGARVSERWI
PVQRVGLYVPGGKAVYPSSVIMNVVPAQAAGVESLAIATPPSRNNADGLPDKTILATCSI
LGVDEVYAVGGAQAVAMFAYGAKGSEPQDGEILCDPVDKITGPGNIFVATAKRMVSGIVG
IDAVAGPTEIAIIADGGANPSWLAADLIGQAEHDELAGSVLITDSEDIAAKVQENLKYRV
PRTEHAERVETSLRGRQSGIILTDGIEQSIDAANAYAAEHLEIQTADPDAVIAKIRNAGA
IFRGPYSPVPLGDYMSGSNHVLPTSGTARFASGLGVHTFMKPVEVIEYDEQGLKTLAARV
NAFAVSEDLPAHGECVLSRFIDDPYDKATITEQEERAGLR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcattgatctgcgtggtaggaagctgacccgagccgaaatgctggatgctatg
ccgcgtgcggagatgggcaccaacgaggccactgaactcgtgcagccgattctcgacgac
gtgaaggcccgcggcgctgcggcccttcgcgatttcgcggagaagttcgaccatattcgc
cccgagaacctgcgcgtgcctgtcgaggtcatgaaggccgccgtcgacgaactcgacccg
gaggtgcgtgccgccatcgaggagtccgtgcgccgttctcgcgccgtatccgcctcccag
gtaccggccccgttccacaccgatctggccgaaggagcccgtgtgtccgagcgctggatt
ccggtgcagcgcgtcggcctgtatgtgccgggcggcaaagccgtgtatccgagctccgtc
atcatgaacgtggtgccggcacaggccgcaggcgtcgaatccctcgccatcgcgaccccg
ccgagccgcaacaatgccgacggtcttcccgacaagaccattctcgccacctgctccatc
cttggcgtagatgaagtctatgcggtcggcggtgcccaggccgtggccatgttcgcctac
ggtgccaagggctccgagccgcaggacggtgagatcctgtgcgatccggtcgacaagatc
accggtccgggcaacattttcgtggctaccgccaagcgtatggtctccggcatcgtcggc
attgacgccgtcgcaggtccgaccgaaatcgccatcatcgccgacgggggtgccaatccg
agctggcttgccgccgatctgatcggccaggccgaacacgacgagcttgccggctccgtg
ctcatcaccgacagcgaggatatcgccgccaaggtgcaggagaatctcaagtaccgtgtg
ccgcgcaccgaacacgccgaacgtgtcgaaacgtcgctgcgcggtcgtcagtccggcatc
atcctcaccgacggcatcgaacagtccatcgacgcggccaatgcatacgcggccgagcac
ctcgaaatccagaccgccgatccggatgccgtcatcgccaagatccgcaatgccggtgcc
atcttccgcggcccgtattccccggtgccgctgggtgactacatgtccggctccaaccat
gtgctgccgacttccggcaccgcacgtttcgcctccggcctcggtgtacacaccttcatg
aagccggtcgaagtcatcgaatacgacgaacagggcctgaagacccttgccgcccgtgtg
aatgccttcgccgtttccgaagatctgccggcgcacggtgaatgcgtgctcagccgtttc
attgacgatccgtacgacaaggcgaccatcacggaacaggaagaacgggcgggcctgcga
tga

DBGET integrated database retrieval system