KEGG   Bifidobacterium dentium: BDP_1617Help
Entry
BDP_1617          CDS       T01143                                 

Gene name
ispC
Definition
IspC 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bde  Bifidobacterium dentium
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bde00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1813780..1814958)
Genome map
AA seq 392 aa AA seqDB search
MQTSTVVILGSTGSIGTQGLDVISRHPDRFDVVGLAAGGAHVDLLARQAAQFHVSSVAVF
DEHAVQPLRDALAQAGAAHVEVTAGPEAVVNMAGSGADVVLNGITGSIGLEPSIAALRSG
SQLALANKESVVAGGHLLFDAQVRAQQINPVDSEHSAIWQSLRSGTHGEVSKLVVTASGG
PFRGWTRNQMIDITPEQALNHPTWHMGPVVTINSSTLMNKGLEVIEASRLFDVPPSRIEV
TVHPQSIVHSMVEFRDGATIAQASPPDMRLPIALGLSAPERLGDVAAACDWTKAATWTFE
PLDDEAFPAVNLARHCLEASEKHTAVLNAANEQAVHAFLEHRLPYLGIVDTVKEVLDDMD
CEMRGNPLFASVEEMSQLEHEARRRADELINK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcagacttcaacagtcgtaattcttggatccaccggttctatcggcacgcagggcctc
gacgtcatctcacgccatcccgatcgcttcgacgtggtcggtttggcggccggcggtgcg
catgtggacctgcttgcccggcaggccgcgcagtttcacgtttcaagcgtggccgtgttc
gacgagcatgccgtgcaaccgttgcgtgatgctctggcacaggcgggagctgcacatgtc
gaagtgaccgccggacccgaagccgtggtgaatatggccggttccggtgccgatgtggta
ctcaacggcattaccggttcgattggtcttgagccgtccattgcggcgctgcgatccggc
tcccagcttgcattggcgaacaaggaatccgtggtggccggcggtcacctgctgttcgac
gcgcaggttcgtgcgcagcagatcaacccggtcgattccgaacattccgccatctggcag
tcgctgcgttccggcacgcatggcgaggtgtccaaactggtcgtaaccgcatccggcggt
ccgttccgcggttggacgcgcaatcaaatgatcgacatcacgcccgagcaggcattgaac
catccgacttggcatatggggccggtcgtaaccatcaactcgtccacgttgatgaacaag
ggcttggaagtgattgaggcgagccgattgttcgacgtgccgccaagccgcatcgaggtg
accgtgcacccgcagtccatcgtgcattcgatggtcgagttccgtgatggcgccaccatt
gcgcaggcttcgccgccggacatgaggctgccgatcgcgttgggactctccgctccggaa
cgacttggcgatgtcgctgcggcctgtgattggacgaaggctgccacatggaccttcgaa
ccgcttgatgatgaggcgttcccggccgtaaaccttgcacgccactgccttgaggcgtcc
gaaaagcataccgcggtactgaacgcggccaacgaacaggctgtgcatgccttcctggag
catcgtctaccgtaccttggcatcgtcgataccgtcaaagaggtgcttgacgacatggac
tgtgaaatgcgaggcaatccgctgttcgcatccgtggaggaaatgagccaactcgaacat
gaagctcgccgtcgtgccgacgaactgataaataagtag

DBGET integrated database retrieval system