KEGG   Bifidobacterium dentium: BDP_1647Help
Entry
BDP_1647          CDS       T01143                                 

Gene name
lacZ1
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bde  Bifidobacterium dentium
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BDP_1647 (lacZ1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    BDP_1647 (lacZ1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BDP_1647 (lacZ1)
Enzymes [BR:bde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BDP_1647 (lacZ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1852683..1855610
Genome map
AA seq 975 aa AA seqDB search
MSEAGFPSDFAQTQCTESGFSSIEVPSNLETKGLLKPQYVNVQYPWDGHEDPQQPNIPQH
NHVALYRREFTPSASVTRAIRENRQITLTFHAASTAIYVWLNGTFIGYAEDSFTPSEFDV
TDAIQEGHNTLAVACFEFSSAAWLEDQDFWRLHGLYRSVELTAIPAAHVRDWKIDPDFDA
TTGDATLAFVASISNADAASKAVATLYGTDGTIAWQSEQLPVNEMITTEAVIANIKPWSA
EEPNLYTLDLTLYGADGTVIEVSRERIGFRHFAIENGVMKLNGKRIMFKGVNRHEFDARR
GRAVNEEDMLYDITFFKQHNINAVRTSHYPNQERWYELCDEYGIYMIDETNIETHGSWTA
PSDPVTPDTNVPGSKSEWQEACVDRIESMMRRDYNHPAVVIWSLGNESYAGTVFKAMSDF
AHANDPLRPVHYEGVFWNRQFDDISDMESRMYAKPAEIAEYLEANPKKPYISCEYMHAMG
NSVGGMHLYTELERYEQYQGGFIWDYIDQALFQRLPDGTERLTYGGDWDDRPNDYEFSGD
GIIFADRTASPKAQEVKQLYANVNIKPDAHGVTIRNENLFVSTADYVFTARMLINGEERW
QADYRFDVAAGASERFDIAFPAASDLMASRCDEELPNGSIEVTYEVDQRLAEATAWAPAG
FELTFGQHVQVFNDAADTDAAAMTDGHTHDVTVTDGRWNAGVKAGGREALLSKAQGGLVS
FTRDGHEMLSRKPSLLTFRPLTDNDRGNASGFDRAQWFAAGRYAKTVGTEIVRDGNTIVG
TYTYELAIAQRTKVTARYELLEDGRIHLTLTYPGGIEAASLPAFGMEWMLPVEYSNLRFY
GLGPAETYRDRLHGAKLGVFESTAEADNAPYLVPQETGNHEGLRWIEVTDRHGHGMRVSQ
AGDEHFAASLLPYSTLMLEEATHQEELPTPRHMFLRLLAAQMGVGGDDSWGAPVHERFQL
PADRPLTLDVMLELF
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagccggattccccagcgacttcgcccagacccaatgcaccgaatccggattc
tcatccatcgaagtgccatcgaatctggaaaccaagggcttgctgaaaccgcaatacgtc
aacgtgcaatacccatgggacggccatgaggatcctcagcagccgaacattccgcagcac
aaccacgtggcgctgtaccgcagggaattcacgccgtccgcatccgtgacccgtgccatc
cgcgaaaaccgtcagatcacgctcaccttccacgccgcatccaccgccatctacgtgtgg
ctgaacggtacattcatcggctacgccgaagattccttcacaccgagtgaattcgacgtg
accgatgccattcaggaaggccacaacacccttgccgtcgcatgcttcgaattcagtagc
gcagcatggctcgaagaccaggacttctggcgcctgcacggactgtatcgcagcgtcgaa
ctcaccgccatccccgccgcacacgtacgcgattggaaaatcgaccccgatttcgacgcc
acgaccggcgatgcgacgctcgccttcgtcgcatccatcagcaatgcggacgctgcttcc
aaggccgtcgcaacactgtacggaaccgatggcaccatcgcatggcagtccgaacaactg
ccggtaaacgaaatgatcaccacggaagccgtaatcgcgaacatcaagccgtggagtgcg
gaagagccgaatctatacacgctcgacctgacgctgtacggtgcggacggcacagtgatc
gaagtcagccgcgagcgcatcggcttccggcatttcgccatcgaaaacggcgtgatgaag
ctcaacggcaagcgcatcatgttcaagggcgtgaaccgtcatgagttcgacgcccgccgt
ggccgcgcggtgaacgaggaagacatgctgtacgacatcacgttcttcaagcagcacaac
atcaacgccgtgcgcacctcacactatccgaatcaggaacgctggtacgagctgtgcgat
gagtatggcatctacatgatcgacgaaaccaatatcgagacgcatggttcatggaccgca
ccgagcgacccggtcacgccggacaccaacgtgccgggcagcaaatccgaatggcaggaa
gcatgcgtggaccgcatcgagtcgatgatgcgccgcgactacaatcatccggccgtggtg
atctggtcgttgggcaacgaatcgtatgcaggtacggtgttcaaggcgatgagcgatttc
gcgcacgccaacgatccgctgcgtccggtgcattacgagggcgtgttctggaaccgtcag
ttcgatgacatttccgacatggaaagccgcatgtatgccaagccggcggaaattgcggaa
tatctcgaagccaatccgaagaaaccatatatctcatgcgaatacatgcatgccatgggt
aactccgtcggtggcatgcatctgtacaccgaactggaacgttacgagcagtatcagggc
ggcttcatctgggattacatcgaccaggcgcttttccagcgtctgccggacggcaccgaa
cgcctgacgtatggtggcgactgggacgatcgtccgaacgattacgaattctccggcgac
ggcatcatcttcgcggaccgcactgcctcccccaaggcgcaggaagtcaagcaattgtat
gcgaacgtgaacatcaagccggatgcgcacggtgtgacgattcgcaatgagaatctgttc
gtctccaccgccgactacgtattcacggcgcgtatgctaatcaacggcgaggagcgctgg
caggctgactatcgcttcgacgtggcggccggtgcgagcgaacgtttcgacattgcattc
cctgccgcgtccgatctgatggcgagccgttgcgacgaggagttgccgaatggttcgatc
gaggtgacgtacgaggtcgatcagcggctggccgaggccaccgcctgggctccggccgga
ttcgagctgacgttcgggcagcatgtgcaggtcttcaacgatgccgccgacaccgatgcc
gccgcgatgaccgacggccacacgcatgatgtgacggtcaccgacggacgctggaacgcc
ggcgtgaaggcgggcggccgcgaggcattgctatccaaggcacagggaggactcgtctcc
ttcacccgcgatggccatgaaatgctttcgcgcaagccgagcctgctgacgttccgtcct
ctgaccgacaacgaccgcggcaatgcctccggcttcgaccgtgcacaatggttcgctgcc
ggccgttacgccaagacggtcggtaccgaaatcgtccgtgatggcaatacgatcgtcggc
acgtacacgtatgaactggcaatcgcgcaacgcacgaaggtcaccgcacgctacgagctg
ttggaagacgggcgaatccatctgaccctcacctatccgggcggcatcgaagcggcttcg
ctaccggcgttcggcatggaatggatgctgccggtcgagtattcgaacctgcgcttctac
ggtctgggaccggccgaaacctatcgtgaccgcctgcacggcgccaagctcggcgtgttc
gagagcactgccgaagcagacaacgcaccgtatctggtgccgcaggaaaccggcaatcat
gaggggctgcgctggattgaggtgaccgaccgccatggccacggcatgcgtgtgagccaa
gccggcgacgaacacttcgcggcaagcctgctgccctacagcacgttgatgctggaagag
gcgacccatcaggaggagctgccaaccccacgtcacatgttcctgcgtctgcttgcagcg
cagatgggcgtcggcggcgacgattcgtggggcgcaccggtgcatgagcggttccagcta
ccggccgatcgaccgctcacgcttgatgtgatgctggagctgttctga

DBGET integrated database retrieval system