KEGG   Bifidobacterium dentium: BDP_1680Help
Entry
BDP_1680          CDS       T01143                                 

Definition
glycosyl hydrolases family 30 (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bde  Bifidobacterium dentium
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bde00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bde00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1894672..1896018)
Genome map
AA seq 448 aa AA seqDB search
MTTWTATTQDDRLVDKTSEIESTNSASASDLQLDGNEYQALRGFGGCFNELGWLPLQTVT
EEERDQIIKELFSPDEMNFTFNRAPVGANDFADHWYSYDETDGDYEMEHFSVEHDEKTLI
PYIHRAQEWQPDMQLFSSPWSPPTWMKRPKAYNYGRLVQTPENLKAYAKYFVKYVQAYAE
HGITVNQLHVQNEVFADQKFPSALWDSEALKVFIRDYLGPAFDEAGIDTDIWLGTLNGPE
DMAWTGGGYGMKLNNYNRFVDNILFDDDARKYIKGIAYQWAGQNCIARTHESWPEIELIQ
SESECGTGDNSWEYAEYIFHLINHYLRNGATAYTYWNMILDDQDSTWGWWQNSLFTITAD
KHEVRRNPEYYVMRHFSHYVKPGAKVLGTTGHFNSMAIAFRNPDGTVVVVVQNALDEERP
FEFADPSSANRGFKVTLAPRSFNTFVLD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctggaccgcaaccacacaagacgacagactcgtcgacaaaacttccgaaatc
gaatccaccaactccgcctccgcctccgacttgcagctcgacggcaatgagtatcaggcc
ctgcgtggcttcggtggctgtttcaacgagctcggctggctgccactgcaaacggtcacc
gaagaggagcgcgaccagatcatcaaggaactgttcagtcccgacgagatgaacttcacc
ttcaatcgtgcacccgtcggtgccaacgattttgccgaccactggtacagctacgacgag
accgacggcgattacgagatggagcatttctccgtcgagcatgatgaaaagactctgatt
ccgtacattcatcgtgcacaggaatggcagccggatatgcagctgttctccagcccgtgg
agtccgccgacgtggatgaagcgcccgaaggcctacaactacggccgtcttgtgcagacg
ccggagaacctcaaggcctacgccaagtattttgtcaagtatgtgcaggcctacgccgaa
cacggcatcaccgtgaaccagctgcacgtgcagaacgaggtgttcgccgaccagaaattc
ccgagcgccctatgggattccgaagcgctcaaggtgttcatccgcgactatctcggtccc
gcgttcgacgaagccgggatcgacaccgacatctggctgggcacgctcaacggcccggaa
gacatggcgtggaccggcggcggctacggcatgaagctcaacaattacaaccgtttcgtc
gacaacatcctcttcgatgacgatgcgcgcaagtacatcaaaggcatcgcctaccagtgg
gccggacagaactgcatcgcacgtacgcatgagtcgtggccggaaatcgagctgattcag
tcggaatccgaatgcggcaccggcgacaacagctgggaatatgcagagtacatcttccac
ctgatcaaccattacctgcgcaacggcgccaccgcctacacctactggaacatgatcctc
gacgaccaagattccacatggggatggtggcagaactcgctgttcaccatcaccgccgac
aagcatgaagtgcgccgcaatccggaatattacgtgatgcgccacttctcgcactacgtc
aagccgggtgcgaaggtgctcggcactaccggccacttcaactcgatggccatcgcattc
cgcaatccggacggcacggtggtggtcgtggtccagaacgccctcgatgaggagcgtcca
tttgagtttgccgatccttcgtccgctaaccgtggattcaaggtgacgctggctccgcgt
tcgttcaacacgtttgtgttggattag

DBGET integrated database retrieval system