KEGG   Bifidobacterium dentium: BDP_1683Help
Entry
BDP_1683          CDS       T01143                                 

Gene name
lacZ5
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bde  Bifidobacterium dentium
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BDP_1683 (lacZ5)
Enzymes [BR:bde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BDP_1683 (lacZ5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1898639..1900765)
Genome map
AA seq 708 aa AA seqDB search
MSRNSVDHILFGAAYYDEYLMMKGIDRIDEDMRMMKDAGLNVIRIAESTWSTCEPQPGKF
DFTYVDRALDAAQRAGIDVIVGTPTYAVPGWLVKLDPSVLAVTPNGEGKYGARQIMNIVN
ATYRFYGERVIRRLISHVADHPAVIGYQVDNETKYYDSVSDDMQRLFVKYLYEKFDGDLD
EMNHHFGLDYWSNRVDSWEDFPDVTATINESLGGEFDKFRRDQVRAFLQWQADIVREYAH
DNQFITHNFDFEWRGYSFGVQPAVDHFKASTAVDITGVDIYHPTEDDLTGKEIAFGGDMT
RSTKDGRNYLVLETEAQGQHGWVPFPGQLRLQAYSHLASGADMVEYWHWHSIHNSFETYW
KGLLSHDLEPNPTYREAGVFGREIAKPEVGERLVHLKKRNKVAIMVSNESLSALDWFLIE
SGFPFGGGLKYNDVVRNVYDALFELNVECDFIPSDADAERLARYGMIVTPALYCTGQKTT
DRLRKFVENGGHLVSTMRSFVSDDEVSVWADRAPHNLTDVFGMTYNQFTRPNGHVSVEFA
GALEGVPSTQALSLIELVTPADGTEVLATYGHYAWKDYAAVTRNTFGKGSAEWIATLLDA
ESIRAVMREAVEYAGVAGAGTALAGRIAVRQGTNTQGETVTYLLNYSASDVTIASPVPGE
VVVAPVVIASEGEIDEVATADVALKAGDAVAIGDELTIGRWNVVVIVG
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcaacagcgtggaccatatccttttcggcgccgcctactacgacgaatacctc
atgatgaagggcatcgatcgtatcgatgaggatatgaggatgatgaaggacgccgggctc
aacgtgattcgcatcgccgaatccacgtggagcacctgtgaaccccaaccgggcaaattc
gacttcacctatgtggaccgcgccctcgacgcggcccagcgcgccggcatcgacgtcatc
gtcggtacgccgacctacgccgtgcccggctggctcgtcaagctcgacccgagcgtgctc
gccgtcaccccgaacggcgaaggcaaatacggcgcacgccagatcatgaatatcgttaac
gccacctaccgtttctacggtgagcgcgtgatccgcaggctcatctcccacgtggccgac
catccggcggtcatcggctatcaggtggataacgagaccaagtactacgattcggtctcc
gacgacatgcagcgtctgttcgtcaaatacctgtacgagaaattcgatggcgacctcgat
gagatgaaccatcactttggcctcgactactggtccaatcgtgtggactcctgggaggac
ttcccggatgtgaccgcgaccatcaacgaatccctcggcggtgagttcgacaagttccgc
cgcgaccaggtgcgcgccttcctgcagtggcaggccgacatcgtgcgcgaatatgcgcac
gacaaccagttcattacccacaatttcgatttcgaatggcgtggttattccttcggcgtg
cagccggccgtcgaccatttcaaggcttcgaccgctgtggacatcaccggtgtggacatc
taccatccgaccgaagacgatctgaccggcaaagagatcgcattcggcggcgatatgacc
cgttccaccaaggacggccggaactacctggtgctcgaaaccgaagcgcagggccagcac
ggctgggttccgttcccgggtcagttgcgcttgcaggcatactcccatctggcctccggc
gccgacatggtggaatactggcactggcattccatccacaattcattcgaaacctactgg
aaaggcctgctgagccacgacctggaaccgaacccgacctaccgtgaggccggcgtattt
ggtcgcgaaatcgccaagccagaagtgggggagcgtcttgtccacctgaagaagcgcaat
aaggtggccatcatggtctccaatgaatcgctgtccgcgctggactggttcctcatcgaa
tccggcttcccgttcggtggcggcctcaagtacaacgacgtggtgcgcaatgtgtatgac
gcgttgttcgaactcaatgtggaatgcgacttcataccgtccgacgccgacgccgaacgc
cttgccaggtacgggatgatcgtgaccccggccctgtactgcacaggccagaaaaccact
gaccgtctgcgtaagtttgtggaaaacggcggccatctggtctccaccatgcgttccttc
gtctccgacgacgaggtgagcgtgtgggctgaccgcgctccgcacaacctcaccgacgtg
ttcggcatgacctataaccagttcacccgcccgaacggtcacgtatccgtggaattcgcc
ggcgcgctcgaaggcgttccatccacccaggcgctttcgctgatcgaactggtgaccccg
gctgacggcaccgaagtacttgccacctacggccactatgcatggaaggattatgcggcc
gtgacccgcaacaccttcggcaaaggcagcgccgagtggatcgccaccttgctggatgcc
gaatcgattcgcgccgtcatgcgagaagccgtggaatatgccggggtcgcgggcgccggc
actgcgctcgcaggtcggattgcggttcgccagggcacgaacactcaaggcgagacggtg
acgtatctgctcaactattccgcctccgacgtcaccatcgccagtccggtgccgggtgag
gtggtggtcgcgccggtcgtaatcgcctcggaaggcgagatcgacgaggtggccacggcc
gatgttgcgctgaaagcgggcgatgccgttgccatcggtgacgaactgacgattggccgc
tggaacgtggtcgttatcgtcggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system