KEGG   Bifidobacterium dentium Bd1: BDP_1754Help
Entry
BDP_1754          CDS       T01143                                 

Definition
(GenBank) Beta-lactamase domain-containing protein
  KO
K12574  
ribonuclease J [EC:3.1.-.-]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:bde00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BDP_1754
Enzymes [BR:bde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BDP_1754
Messenger RNA biogenesis [BR:bde03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     BDP_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1989121..1990797)
Genome map
AA seq 558 aa AA seqDB search
MRIVPLGGLGEIGRNMNVVEYNGHLLLIDCGVLFPEEEQPGVDLILPDFHYIKDRLDKVE
ALVLTHGHEDHIGGVPYLLKLRPDIPLIGSKLTLAFAEAKCKEHHINPTLVEVKGRDKLK
VGPYNLEFVNVTHSIPDALAVFVQTPAGSLIDTGDIKLDQLPLDHRITDLVEFGKLGEKG
VDLLMMDSTNAEVPGFVKPETSIGPALDQAFAQATRKIIVASFSSHVHRVQQVVDAAHKY
GRKVVFVGRSMVRNMSIAADLGYLRLPEDTVIDLKQSHDVQDDKLVYMCTGSQGEPMAAL
GRIADGNHRDITINEFDTVILASSLIPGNEHEVYKVINKLVQLGARVVNRDNAAVHVSGH
CNEGELLYMYNIVKPKCAMPIHGENRHLVANGMIAVKTGVDPQNVVLAEDGDVVDLYHGQ
AAVVGSVPCGYVYVDGDSVGELTDEELEKRRILGTEGFVSSFVVVDTETADVIAGPKIYL
NAVAEDESEFDKVRHQIVEQLRDAMMTGTHDTYKLQQLMRRTLGSWVARQLHRKPMIVPV
VADIAQDVDDAAGVTAAK
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgtgccgctgggcggtttgggtgagatcggtcgcaatatgaacgtggtcgaa
tacaatggccacttgctgctcatcgactgcggtgtgctgtttccggaagaggagcagccg
ggcgtggacctgatcctgcctgacttccactacatcaaggatcgtctcgacaaggtcgag
gctctggtgctcacccacggtcatgaggaccacatcggtggcgtaccgtacctgctgaaa
ctgcgcccggacattccactgatcggctccaagctcacactggccttcgcggaggccaag
tgcaaggagcaccacatcaatccgacgcttgtcgaggtcaagggccgcgacaagctcaag
gtgggcccatacaaccttgaattcgtgaacgtgacccactccatcccggacgctctggcc
gtattcgtgcagactccggccggttccctgatcgacaccggcgatatcaaactcgaccag
ctgccgcttgaccatcgcatcaccgatctggtggaattcggcaagctcggcgaaaagggc
gtggaccttctgatgatggactccaccaacgccgaggtgccgggcttcgtcaagccggag
acctccatcggtccggcccttgaccaggcgttcgcgcaggctacccgcaagatcatcgtg
gccagcttctccagccacgtgcatcgcgtgcagcaggtcgtcgacgccgctcacaagtac
ggccgcaaggttgtgttcgtcggccgttccatggtgcgcaacatgtccatcgcagccgat
ttgggctacttgcgtctgccggaagacaccgtcatcgacctgaagcagtcccatgatgtg
caggacgacaagctcgtctacatgtgcaccggctcccaaggcgagccgatggccgccttg
ggccgtatcgccgacggcaaccaccgcgatatcaccatcaacgaattcgacacggtgatt
ctggccagctccctgatcccgggcaacgagcacgaggtctacaaggtcatcaacaagctc
gtgcaattgggtgcgcgtgtggtcaaccgcgataatgcggccgtgcacgtctccggccat
tgcaacgagggcgagctgctgtacatgtacaacatcgtcaagccgaagtgcgccatgccg
attcacggtgagaaccgtcacttggtggccaacggcatgatcgccgtcaagaccggcgtc
gatccgcagaacgtcgtgctggctgaagatggcgacgtcgtcgacctgtaccatggccag
gccgcggtcgtcggttccgtgccgtgcggctacgtgtatgtggatggcgattccgtcggc
gagcttacggatgaggagcttgagaagcgtcgtattctcggcactgaaggattcgtgtcc
agcttcgtggtcgtcgacaccgaaaccgccgatgtgattgcggggccgaagatctatctc
aacgccgttgccgaggatgaaagcgaattcgacaaggtgcgtcaccagatcgtcgagcag
ttgcgggatgccatgatgaccggtacccacgatacgtacaagctgcagcagctcatgcgc
cgcacgcttggcagttgggtggcccgtcagctgcatcgcaagccgatgatcgtgccggtc
gtggccgacatcgcgcaggacgtcgatgacgctgcgggcgtaactgcggccaagtga

DBGET integrated database retrieval system