KEGG   Bifidobacterium dentium Bd1: BDP_1756Help
Entry
BDP_1756          CDS       T01143                                 

Gene name
dapA
Definition
(GenBank) DapA dihydrodipicolinate synthase
  KO
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BDP_1756 (dapA)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BDP_1756 (dapA)
Enzymes [BR:bde01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     BDP_1756 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1991181..1992086)
Genome map
AA seq 301 aa AA seqDB search
MTDGTMHLLDPAPFGRILPAMVTPMKADGSVDFEAARKLATQLVADGADGLVVNGTTGES
PTTHMEEKVELVQAVKDVVDVPVISGAGSNDTAHTVRMVEQTQEAGADAVLVVAPYYSRP
SQEGVFRHYKAVNDSADKPIIVYDVPGRTGLHIQLETYRRLAELDHVKAVKDATGDIAGA
VRKRMETGLTWYSGDDGLFLPFLSVGAVGIISVIAHAAAGPMRDLANAFDRGDIHEAQRL
AVQLAPLVESMNGNGFQAVMAKASLKVRGILDDTTMRLPNVGPGEAEIKRAEAGMRASGL
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgactgacggtacgatgcatcttctcgatcccgctcctttcgggcgaattctcccggcc
atggtgacccccatgaaggccgatggctccgttgatttcgaggccgcgcgcaagcttgcg
acgcagctcgtggccgacggtgccgatggtcttgtggtcaacggcaccaccggcgaatca
ccgaccactcacatggaggagaaggtcgagctggttcaggccgtcaaggacgtcgtggac
gtgccggtcatctccggtgccggctccaacgacaccgcacacaccgtgcgcatggtggag
cagacgcaggaggcgggcgccgatgcggtgctcgtggtcgcgccatactactcccgtcct
tctcaggagggtgtgttccgtcattacaaggcggtcaacgattcggcggacaagccgatt
atcgtctacgatgtgccaggccgcaccggtctgcacatccagctggaaacctaccgtcga
ctggccgaactcgaccatgtcaaggcggtgaaggacgccaccggcgacatcgcgggagcc
gtgcgcaagcgtatggaaaccggcctgacctggtattccggcgatgatggcctgttcctg
ccgttcctttccgtaggtgcggtcggcatcatctccgtgatcgcgcacgcggcggccggc
ccgatgcgtgacctcgccaacgccttcgaccgtggtgacatccacgaggcgcagcgtctt
gccgtgcaactcgcgccgctggtcgaatccatgaacggcaacggcttccaggccgtcatg
gccaaggcctccctgaaggtacgcggcattcttgacgacaccaccatgcgtctgccgaat
gtcggtccgggtgaggctgaaatcaaacgtgccgaggcaggcatgcgcgcctccggtctg
ctgtaa

DBGET integrated database retrieval system