KEGG   Bifidobacterium dentium Bd1: BDP_1757Help
Entry
BDP_1757          CDS       T01143                                 

Definition
(GenBank) MFS superfamily transporter (cyanate transporter CynX-like protein)
  KO
K03449  
MFS transporter, CP family, cyanate transporter
Organism
bde  Bifidobacterium dentium Bd1
Brite
Transporters [BR:bde02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Cyanate porter (CP) family [TC:2.A.1.17]
    BDP_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1992292..1993548)
Genome map
AA seq 418 aa AA seqDB search
MNAKNAIAEYDVPSTGLWAALVFVVSLNLRPAIAAVGPLLTQIGADLSWGEGVQGVLTAI
PLLAFAAVSPLVTFIERRVGVDMAILSALLCIAVGNFIRSYCGNVGIWLGTVIFASSIAV
GNVLVPVIVKRDYAGHIAMATGVYSGCITVGAATAGLISAPLAQVWCDWRASLAVWSVPP
LVVAALWALRILHNRQIMQTTVPNVTRTNAATTSHESGYDTFRCVLRRPMTWYVTVFMGL
QSSTFYTMSNWIPSVSASAGFDASTAGVHLFIFQGVGILSGLLIPKLMNVRGNQICAALT
SSIPMLVAGLGMLVFPQAMIVWSLIGGCAQGSALVVALALIAMRGQGGAETVVLSGIAQS
FGYLIASLGPLVFGVLMQLTGGRQVSLGLFACMAFLQCVVAVIAGQSSKDGVSRSIGS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaagaatgccattgcggaatacgatgtgccatccactggactgtgggcggca
ctggtcttcgtggtgtcgttgaatctacggccggccatcgccgcagtcggtccgttgctt
acgcaaattggtgccgacctttcctggggcgaaggcgtgcagggcgtcctgacggcgata
ccgctgcttgcctttgccgcggtcagcccgttggttacgttcatcgaacgccgtgtcggt
gtggatatggcgattctgtcggccctgctgtgcattgcggtcggcaatttcattcgctcg
tattgtggcaatgtcggaatctggttgggaacggtgattttcgcttcctcaatcgccgtg
ggcaacgtgctggtgccggtgatcgtaaaacgcgactatgccggtcatattgcgatggct
acaggcgtttactccggctgtatcaccgtaggtgccgccactgcgggattgatttccgct
ccacttgcgcaggtatggtgcgattggcgtgcctcacttgccgtttggagcgtgccgccg
ctagtggtcgcggcattgtgggcgttgcgcatactgcataatcgccagatcatgcaaacc
actgtgccaaacgtgacgcgaaccaatgcagcaaccacctcccatgaatcgggatacgat
acattccgttgtgtactgcgacgtccgatgacatggtacgtcactgtgttcatgggattg
caatcatccactttctacaccatgtccaattggataccgagcgtttccgcatccgctggc
ttcgacgcctccacggccggcgtgcacctgttcatattccagggcgttggtattctttcc
ggtctgctgatacccaagctgatgaatgtgcgcggtaaccagatttgtgcggcgctcact
tccagcattcccatgctggtggcgggtctcggcatgctggtgttcccgcaagccatgatt
gtctggtcgctcatcggcggctgcgcacagggatcagcgctggtcgtggcgctcgcgttg
atcgccatgcgtgggcagggcggtgccgaaaccgtggtgctttcgggcatcgcgcaatca
ttcggttatctgatagcttcgctgggaccactggtattcggcgtattgatgcagcttacc
ggcggtcgtcaggtttcgcttggattgttcgcgtgcatggcgttcctccaatgcgttgtt
gccgtcattgccggacaatcttccaaagatggcgtttcgcgttcgatcgggtcttaa

DBGET integrated database retrieval system