KEGG   Bifidobacterium dentium Bd1: BDP_1774Help
Entry
BDP_1774          CDS       T01143                                 

Definition
(GenBank) ATPase
  KO
K03924  
MoxR-like ATPase [EC:3.6.3.-]
Organism
bde  Bifidobacterium dentium Bd1
Brite
Enzymes [BR:bde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     BDP_1774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2020625..2021950
Genome map
AA seq 441 aa AA seqDB search
MSNAFDDATQLSERSNEPHGKQGFTMPKLPERLGIEHHESTDVDGTVLGTHGTTAPVTTN
APTVTPTAAAPTITITPDTAAPTERMASWQATTERQPAASEQVRRQPAAGTMPETLNTGM
VPAAGADIVEFHDKFNALVENVSKVVVGKDGPIRQCITAMVVGGHVLLEDNPGTGKTQLA
RGLANSIDMSFKRIQFTPDLLPSDVVGVTYYDQKRSEFEYREGPVFASVVLADEINRASP
KTQSALLEVMEEQKVTVDGVTHAVPQPFMVIATQNPIEQLGTYKLPEAQMDRFLIKTTVG
YPSHEVSVDILRQVNVTDRAAAVHHVLSGDDVLRMRAVSETVRLDDAIIEYIVRLVEATR
HNERIQVGSSMRGALALTRCARVWAAADNRGYVVPDDVKDLAVSVLAHRITLTAEATFAG
ATAEQMISQILEEVPAPTLGA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgcattcgacgatgccacccagctgagcgagcgcagcaacgaaccgcacgga
aagcaaggcttcaccatgccgaagctgccggaacgcctcgggatcgaacatcatgagtcc
accgacgtggacggtacggtattgggcacgcatggcacgacggccccggtgacgacgaac
gctccgaccgtcacaccgaccgccgccgccccaaccatcacgatcacaccggacaccgcc
gccccgaccgagcggatggcatcgtggcaggcaacaaccgaacggcagccggccgcctcc
gagcaggttcgtcggcagccggcggccggcaccatgccggaaaccctgaataccggcatg
gtgccggccgccggcgccgatatcgtcgaattccatgacaagttcaacgccttggtggag
aacgtttccaaggtggtggtcggcaaggacggcccgattcgccaatgcatcaccgccatg
gtggtgggcggccatgtgctgctcgaagacaatccgggtaccggcaagacccagttggcg
cgaggtctggccaattccatcgacatgtcgttcaagcgtatccagttcacgccggatctg
ctaccgtccgacgtggtcggcgtaacctactacgaccagaagcgaagcgaattcgaatac
cgtgagggcccggtcttcgcctccgtcgtgctcgccgacgagatcaaccgcgcctcaccg
aaaacgcagtccgcactgctcgaggtcatggaggagcagaaggtcaccgtcgatggcgtg
acccatgccgtaccgcagccgttcatggtgatcgccacgcagaatccgatcgaacaactc
ggcacctataagctgcccgaagcgcagatggaccgattcctcatcaagaccaccgtcggc
tacccaagccatgaggtgagcgtcgacattctgcgtcaggtcaacgtcaccgaccgcgct
gccgccgtgcatcacgtgctttccggcgacgacgtgctgcgcatgcgcgccgtcagcgag
accgtacgcctcgatgacgccatcatcgaatacatcgttcgcctggtcgaagcgacccgg
cataacgaaaggatccaagtgggctcctccatgcgaggcgcgctggcgctcacccgttgc
gcccgtgtgtgggccgccgccgacaatcgcggctatgtagtgcccgacgacgtgaaggat
ctggcggtctccgtgctcgcacaccgcatcacgctcaccgccgaagccacattcgccggt
gccacggcggagcagatgatctcgcagattctcgaggaagtgccggccccgaccctgggc
gcctga

DBGET integrated database retrieval system