KEGG   Bifidobacterium dentium Bd1: BDP_1777Help
Entry
BDP_1777          CDS       T01143                                 

Gene name
prpC
Definition
(GenBank) Protein phosphatase PrpC
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2025568..2026467
Genome map
AA seq 299 aa AA seqDB search
MNANRIVTGLNSDIGLRRASNQDNALAGHGIFVVCDGMGGGMGGERASEAVVRHCAQLGA
KAARNRHDIEETLNAAQREVLALGESLGGIAGTTISGVIMPADIDDMTAHAADANSIADG
NDSCYIVNIGDSRTYHMCAAEDGGWDASTFTRITRDHSERQNAIDSGEMLPEEALRNIPR
NIITQCIGAPNGIAPDYYAADAFGRFIICSDGLHAEVDKERFAAIAAADNDPQTAADALV
KAALRAGGNDNVTVVVVDMITPSPIGREWTVGKLAEHEDIGDLQDGTLQTLRTIDVRRS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgaaccgtatcgtgaccggcctgaacagcgatatcggactgcgtcgcgccagc
aatcaggacaatgccctggccgggcatggcatattcgtcgtatgcgatggcatgggcggc
ggcatgggcggcgagcgggcaagcgaggcagtggtgcgccattgtgcgcagcttggcgcc
aaggccgcgcgcaaccggcatgatatcgaagagacgctgaatgccgcgcaacgtgaggtg
ctggcattgggcgaatcgttgggcggcatcgccggcaccacgatttccggtgtgatcatg
cctgccgatatcgatgacatgacggcccatgcagccgatgccaacagtatcgccgacggc
aacgattcctgctatatcgtcaacatcggcgattcacgcacctaccatatgtgcgctgcc
gaagacggcggttgggatgcgagcacgtttacccgcatcacccgcgatcattcggagcgc
cagaacgccatcgattccggggagatgctgcccgaggaggcgttgcgaaacatcccgcgc
aacatcatcacgcagtgcatcggagcgccgaacggcatcgcacccgattattacgcggcg
gatgccttcggacgtttcatcatctgctcggacggcctgcatgccgaagtggacaaggaa
cgtttcgccgccatcgcggccgccgacaacgatcctcagaccgccgccgacgcgttggtc
aaagcggcgctgcgggccggtggcaacgacaacgtgaccgtggtggtagtcgacatgatc
acaccttcgcccatcgggcgggagtggacggtcggcaaactcgccgagcatgaagacatc
ggcgatctacaagacggcacattacaaacattacgaaccattgatgtaaggagatcatga

DBGET integrated database retrieval system