KEGG   Bifidobacterium dentium Bd1: BDP_1778Help
Entry
BDP_1778          CDS       T01143                                 

Definition
(GenBank) Hypothetical protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2026464..2027189
Genome map
AA seq 241 aa AA seqDB search
MMVDYDTAVAAVQDPNADPAFLAKIAYENPEFGANVAAHQRAYPGLIRWLAQFGDDRARQ
IVIQRGYAVPETAVAPHEQPAQDSPAQDSPVQERQFAQERQPIQEQLVRSAQEQPVVQDN
QAQPVHQAQPIHQNQPITDTSTEYLDPYTNPADLSEVADYAEPVQEQPQPQPQQPIARNP
YGFTAQMALTTTDQMQIAQIAQYAPELRACIARNPNTYPALLEWLAQLNDPAINAALRTR
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgatggttgattacgataccgcggtcgcggcggtgcaggatccaaacgccgatcccgca
ttcctggcgaagatcgcctatgagaacccggaattcggggcgaatgtcgcagcgcatcag
cgcgcataccccgggttgattcgctggctggcccagttcggcgacgaccgtgcacgccag
attgtgatccagcgcggctatgccgtacctgagaccgcagtggcgccacacgaacagccg
gcacaggattcgccggcacaggattcgccggtgcaggagcggcagtttgcgcaggagcga
cagccgattcaggaacagctcgtacggtccgcgcaagagcaacctgtagtgcaggacaat
caggctcagccagtccatcaggctcagccgatccatcaaaaccagccgatcaccgacact
tcgaccgaatatcttgacccctacaccaatcctgccgatctgtccgaggtggcggattat
gccgaacctgtgcaggagcagccgcaaccacagccgcagcagccgattgcacggaatccg
tatggcttcaccgcgcaaatggcactgaccaccaccgatcagatgcagatcgcacagatc
gcacagtacgcgccggagctgcgtgcctgcatcgcacgcaatcccaacacctatccggca
ttgctggaatggttggcgcagttgaacgatccggccatcaacgccgccttgcgcactagg
cagtga

DBGET integrated database retrieval system