KEGG   Bifidobacterium dentium Bd1: BDP_1780Help
Entry
BDP_1780          CDS       T01143                                 

Definition
(GenBank) Hypothetical protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2028126..2029238
Genome map
AA seq 370 aa AA seqDB search
MDDQLPTDGTQPNSARTPSHAQTQPQTSSTADRQPQQPAQPQANQQPMPPYQQTPPQYQQ
TAPQYQQPMPGRPGVPGQPGTPLMQGQPYGQPMPQSAAKKPATGLIVGIVTAVIAVIVVL
AVVVTMIMSKRITAADYTAGENQVLTMQKHYASVNEKLRDAYLSAYGSSSFQDTDKKRLK
DRLKTLQNDNAKFESLKVMNDETVNKEYQAYKKKTATYIKFVDEMIESGESLSKAAKACN
SSPSVSSYDNSFYTKYGEYVSACKAALDDVSKSPNKDIAQYGKDLGDYVDKLGDIISSMQ
AIGDISSLQYGTTQYQQFRDLLDEFNNLEAPYSSVSTLSQALQDSAEEADLSDSLRSLYD
ALTDGADHAH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccaacttcctaccgatggcacgcaaccgaacagcgctcggacgccatcccat
gcacagactcaaccgcaaacgtcaagcacggcggatcggcagccccagcagccggcacag
cctcaggccaaccagcaaccgatgccgccatatcaacagacgcctccgcagtaccagcaa
acggctccgcagtatcagcagccgatgccgggtcggccgggcgtgccgggtcagccggga
acccctctcatgcaggggcaaccgtacgggcagcccatgccgcagagcgccgcgaagaag
ccggcgaccggcctgatcgtaggcatcgtaacggcggtgatcgccgtcatcgtcgttctt
gccgtagtggtgacgatgattatgtcgaaacgcatcaccgccgccgactacacggccgga
gagaatcaggtgctcaccatgcagaagcattatgcgagcgtgaatgagaagctgcgcgac
gcctatctgtccgcatacggcagcagttccttccaggacacagacaagaagcgtctcaag
gaccgtctcaagaccctccagaatgacaacgcgaagttcgaatccctgaaggtcatgaac
gatgagaccgtcaataaggaatatcaggcgtataagaagaagaccgcgacatacatcaag
ttcgtcgacgagatgatcgaatccggcgaatcgctctccaaagcggcgaaggcctgcaac
agcagccccagcgtcagctcttacgacaacagcttctacaccaagtacggtgagtatgtg
tccgcctgtaaggccgcactcgacgatgtctccaagtcaccgaacaaggacatcgcacag
tatggcaaggatcttggcgattacgtcgataagctcggcgatatcatctccagcatgcag
gccatcggcgatatcagctcgctgcagtatggcaccacgcagtaccagcagttccgtgac
ctgctcgacgagttcaacaatctggaggcgccgtacagcagcgtgagcacgttgagccaa
gcgttgcaggattccgcggaggaggccgacctgagtgattccctgcgctccctgtatgac
gctttgacggatggcgccgatcatgcccactga

DBGET integrated database retrieval system