KEGG   Bifidobacterium dentium Bd1: BDP_1785Help
Entry
BDP_1785          CDS       T01143                                 

Definition
(GenBank) RNA methyltransferase
  KO
K03216  
tRNA (cytidine/uridine-2'-O-)-methyltransferase [EC:2.1.1.207]
Organism
bde  Bifidobacterium dentium Bd1
Brite
Enzymes [BR:bde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.207  tRNA (cytidine34-2'-O)-methyltransferase
     BDP_1785
Transfer RNA biogenesis [BR:bde03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    BDP_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2038986..2039672
Genome map
AA seq 228 aa AA seqDB search
MTNEERALEAQGAEAAQTATRNAEAKVEKMFEYGYRKSNYGPDELVTDAHGNPISVVDAM
LSAEDAAKAETSTPHLCYYSPRIPGNTGSAIRLCAVTGTILHLVEPLGFNLRDTKLRRAG
LDYHDMAHVVLHPDFDNLVQSMPNSRIIAFTAHATKLYTEIEYKPTDILLFGPEPGDIPD
PMDIMAGPHVAEQVRLPMRPSLRSLNLTNCASIAIYEAWRQLNFIGGK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgaagagcgtgcccttgaagctcagggcgcagaagctgcacagaccgccacg
cggaacgcggaggccaaggtcgagaagatgttcgaatacggctaccgtaagtcgaattac
ggtccggatgagttggtgaccgacgcgcatggcaatccgatttccgtggtcgacgcgatg
ctgtcggccgaagacgcggccaaggccgaaacctccacaccgcatctgtgctactactcc
cctcgtattccgggcaataccggttccgcgatccgcctgtgcgcggtgaccggcacgatc
ctgcatttggtggagccgcttggtttcaatcttcgtgatacgaagctgcgccgtgcgggc
cttgactaccatgacatggcacatgtggtgctgcatccggatttcgacaatctggtgcag
tccatgccgaattcgcgcatcatcgcgttcaccgcgcatgccaccaagctgtacacggaa
atcgaatacaagccgaccgatattctgctgttcggcccggagccgggcgacattcccgat
ccgatggatatcatggccggccctcacgtggccgaacaggttcgcctgcccatgcggccg
agcctgcgctccctgaatctgacgaactgcgcctccatcgccatctatgaggcgtggcgt
cagttgaattttatcggcggtaagtaa

DBGET integrated database retrieval system