KEGG   Bifidobacterium dentium Bd1: BDP_1791Help
Entry
BDP_1791          CDS       T01143                                 

Definition
(GenBank) Sugar kinase, ROK family
  KO
K00881  
allose kinase [EC:2.7.1.55]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BDP_1791
Enzymes [BR:bde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.55  allose kinase
     BDP_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2045553..2046551
Genome map
AA seq 332 aa AA seqDB search
MNNIDTTPATATAIANNEPIVATADSPVNSATLKTPVVLGIDIGGTNLRVGLVDALGALV
DSRRVSSQEALSGSDPMTKLADYLEGYLAEMLDGKYELKAISVGFPSVVDATRTVVLQTT
FIPGLNNVNVPERLSRFGVPVFIDRDVNMIIRYDAKRLNLQNLEGVTFGCYVGTGIGCAL
AVDGKILAGLHGVAGELGHIYEATGRTCGCGLEGCSETAASGNALVRELEAHHPGASIDD
AFSEYGDEQFIDDWLEHLAWTFSTVINLLDPAKIIIGGGVTQMKGFPKQRLEEKIKRMSR
KPYPAEDLPIVYTIPGKYDGVIGAALCALEQI
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacatcgatacaactccggcaaccgcaaccgcaatcgccaacaacgagccgatc
gtcgccaccgccgacagcccggtcaattccgccacgttgaagaccccggtcgtgcttggc
atcgacatcggaggcaccaacctgcgcgtcggcctggtcgacgctctcggtgcactcgtc
gattcccgtcgcgtcagttcgcaggaggctctgagcggcagtgatccgatgaccaagctc
gccgactatctcgaaggctatcttgccgaaatgctcgacggcaaatacgagctgaaggcg
atttccgtcggcttcccgtccgtcgtcgacgctacacgcaccgtagtgttgcagaccacg
ttcattccaggattgaacaacgtgaacgtgccggaacgactgagccgcttcggcgtaccg
gtgttcatcgaccgcgacgtgaacatgatcatccggtacgacgcgaaacgcctgaatctg
cagaatctcgaaggtgtgaccttcggctgctatgtcggcaccggaatcggctgcgcgctg
gcggtggacggcaagattctggccggcctgcacggcgtggccggggaactcggtcacatc
tacgaagcgaccggcaggacctgcggctgcgggttggaaggctgctccgaaacggccgcc
tccggcaatgcgctggtacgtgagctcgaagcgcaccatccgggcgcctccatcgacgac
gcgttcagcgagtatggcgacgagcagttcatcgacgactggctggagcatctcgcctgg
accttctcgaccgtcatcaatctgcttgatccggcgaaaatcatcatcggcggcggcgtg
acgcagatgaaaggcttccccaagcagcgactcgaagagaaaatcaagcgcatgtcccgc
aagccgtacccggccgaggatctgccgatcgtctacaccatccccggcaaatacgacggc
gtaatcggcgcggccctgtgcgcgctcgagcagatctga

DBGET integrated database retrieval system