KEGG   Bifidobacterium dentium Bd1: BDP_1792Help
Entry
BDP_1792          CDS       T01143                                 

Definition
(GenBank) Hypothetical protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2045415..2045516)
Genome map
AA seq 33 aa AA seqDB search
MWPYRDVATAEGDAEPFRIWMKGMKERERPCAK
NT seq 102 nt NT seq  +upstreamnt  +downstreamnt
atgtggccgtaccgggatgtcgctacggctgagggtgacgcagaaccgttccgaatttgg
atgaaaggtatgaaggagagggaacggccctgcgccaagtga

DBGET integrated database retrieval system