KEGG   Bifidobacterium dentium Bd1: BDP_1795Help
Entry
BDP_1795          CDS       T01143                                 

Gene name
galT
Definition
(GenBank) GalT galactose-1-phosphate uridylyltransferase
  KO
K00965  
UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, galactose => UDP-galactose
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BDP_1795 (galT)
   00520 Amino sugar and nucleotide sugar metabolism
    BDP_1795 (galT)
Enzymes [BR:bde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     BDP_1795 (galT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2049440..2050690)
Genome map
AA seq 416 aa AA seqDB search
MSEFATYAPGEYAKEHIRITPTTLADGRDFFYLDDDPEYVSGAKTRELNDPRQLAYRFSN
QLNAAGEEVPYAAPEMRRDPLTGDWIPMATARMNRPITAGPGATAKGNPLAARKPGDPYQ
DGEVPDTDYNVVVFENRFPSMVRVPGRSEAVEYVDGNPLWEKKLAAGRCEVICFDPDEDG
LPADLPVSRLRTVVEAWAFRTAEISKIDGIEQIFPFENHGQEIGVSLAHPHGQVYCYPFI
APKMEAELQHTEAYHEKTGGNLLKDLMNAEIEAEERIVMRNHSWVAYVPAAARWPLEVHV
APVRDVLTLDELNDQERWDLAVMYSTLLKRGNAFFDKGDGKGMDLPYIAAWHQAPIHDAR
RENYRLNLQFFSFRRAANKIKYLAGSESGMAAWVSDTTPELIAKRFHELGPIDIEG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattcgcaacctatgctcctggagaatatgcgaaggaacacatccgtatcacc
ccgaccacgcttgccgatggccgtgacttcttctatctcgacgacgatccggaatacgtt
tccggtgccaagacccgcgaactgaacgatccgcgtcaattggcctaccgtttctccaat
cagctcaacgcggccggcgaggaagtgccgtacgccgctccggagatgcgccgcgacccg
ctgaccggcgattggattccgatggcgaccgcgcgtatgaaccgtccgatcaccgccggc
cccggtgccaccgccaagggcaatccgctggccgcacgtaagccgggcgacccgtaccag
gatggcgaagtgccggacaccgactacaacgtggtcgtattcgagaaccgtttcccctcg
atggtgcgtgtgccgggccgttccgaggccgtggaatacgtcgacggcaacccgctgtgg
gagaagaagcttgccgccggccgctgcgaagtgatctgcttcgatccggacgaagatggc
ctgccggccgatttgccggtatcccgtctgcgcaccgtcgtggaggcatgggccttccgt
accgccgaaatctccaagatcgacggcatcgaacagatcttcccgtttgaaaaccacggg
caggagatcggcgtttccctggctcacccgcatggtcaggtctactgctacccgttcatc
gcgccgaagatggaagccgagctgcagcataccgaggcctatcacgagaagaccggcggc
aatctactcaaggatctcatgaatgccgaaatcgaagccgaggagcgcatcgtcatgcgc
aaccacagctgggtcgcctatgtgccggccgccgcacgttggcctctcgaggtgcatgtg
gccccggtgcgcgacgtgctcaccctcgacgagctcaacgatcaggaacgctgggacctc
gccgtgatgtactccaccctcttgaagcgtggcaatgcgttcttcgacaagggcgatggc
aagggcatggacctgccgtacatcgccgcatggcatcaggctccgatccacgacgcccgt
cgcgagaactaccgcctgaacctgcagttcttctccttccgccgtgccgccaacaagatc
aagtatctggccggctccgaatccggcatggccgcctgggtctccgacaccacgccggaa
ctcatcgccaagcgcttccacgagctcggcccgattgacatcgaaggctga

DBGET integrated database retrieval system