KEGG   Bifidobacterium dentium Bd1: BDP_1796Help
Entry
BDP_1796          CDS       T01143                                 

Definition
(GenBank) Transcriptional regulator, DeoR family
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoRC HTH_DeoR HTH_11 MarR GntR MarR_2 CoA_trans Put_DNA-bind_N Rrf2 HTH_Mga DUF2250 HTH_24 Sugar-bind TrmB Fe_dep_repress HTH_27 HTH_20 HTH_IclR PaaX AbiEi_4
Motif
Other DBs
NCBI-ProteinID: ADB10383
UniProt: D2Q618
Position
complement(2050696..2051499)
Genome map
AA seq 267 aa AA seqDB search
MISSQRQHLILSRLRTRGAVRITALSKELGVSAMTIRRDIADLADKGLLKRVHGGAVTTS
TLLSEPLFSVKSQMDIGLKDAIAQEAVKYVAPGDVIAIGGGTTAYVFAQHLLESQQSSGI
TILTNSIPVAELVQALESKDVEVIVTGGVTTRSNSLVGPIADKVVASLRVNTVFLGTHSV
SIPRGFLMPNSLEAATDMALMDIADRTIILTDHTKWSCTSLSLFARFDQVDTVITDDGLD
PDSVGKTRDLVKELVLAHQTEQMQESE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgatatcgtcacaacgtcagcatctgatactgagccggttgcgcacccgtggtgcggtg
cgtattaccgcgttatccaaggaattgggcgtttccgccatgaccattcgccgcgatatc
gccgatctggccgacaagggccttctcaaacgcgtgcacggcggtgcggtcaccaccagc
acgttgctgagtgagccgctgttctctgtaaagtcgcagatggacatcggtctcaaggac
gccattgcgcaggaagccgtcaaatacgtggcccccggtgacgtgatcgccatcggcggc
ggcaccaccgcctacgtgttcgcacagcatctgctcgaatcgcagcaatcctccggaatc
accatcctgaccaactccattcccgtggcggaactggtgcaggcgctggaatcgaaagac
gtggaagtcatcgtaaccggcggcgtgaccacccgttccaactcgctggtaggcccgatc
gccgacaaggtggtcgcctccctgcgcgtcaacaccgtattcctgggcacgcattccgtg
tccattccacgcggcttcctcatgccgaactcgcttgaggccgcgaccgatatggcattg
atggacattgccgatcggacgataattttgaccgatcacaccaagtggagctgcacgtcg
ttgtcgctgtttgcacgcttcgaccaggttgacacggtcattaccgatgatggactcgat
cccgattcggttgggaaaacaagggatttggttaaagagctcgtgctggcgcaccagacc
gagcagatgcaggaaagtgagtaa

DBGET integrated database retrieval system