KEGG   Bifidobacterium dentium Bd1: BDP_1797Help
Entry
BDP_1797          CDS       T01143                                 

Definition
(GenBank) Glycosyltransferase
  KO
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
Metabolic pathways
Brite
Enzymes [BR:bde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     BDP_1797
Glycosyltransferases [BR:bde01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   BDP_1797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2051919..2052719)
Genome map
AA seq 266 aa AA seqDB search
MAERVCVVMPTYNELENLHPTVGGIFACRPSVEILIVDDGSPDGTGEEADRMAAEDPRIH
VLHRAGKNGLGPAYLAGFAWALERGFDVVCEMDMDGSHRPQDLPKLLEALAVEGPCDDIV
AEPGDGQSIDRDRGIAAGAIPDLVIGSRRVDGGRTEGWSPFRDFISRSGSWYARTMLGIG
VRDMTAGFRAYRASMLRSLDLDAIEANGYVFQIDMTRRVAAAGGTIVEVPIVFPDRVRGK
SKMSNAIVIEAMRRVTVWGLQRLFHK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgggtctgcgtggtaatgcccacctataacgagttggagaacctgcatccg
accgtcggcgggattttcgcatgccgaccgtcggtcgaaatcctaatcgtcgacgacggc
tctccggacggaaccggcgaggaggccgatcgcatggctgcggaagatccgcgcatccac
gtgctgcaccgcgcaggaaagaacggtctcggaccagcctatctggccggctttgcgtgg
gcgctggagcgtggcttcgacgtggtttgcgagatggacatggacggctcgcaccggcct
caggatcttccgaaattattggaagcgctcgcggtggaggggccgtgcgatgacattgtt
gcggaaccgggcgacgggcaatcgattgatcgcgatcgtgggattgcggccggtgccata
ccggatctggtgatcggctcgcgtcgtgtggacggcggacgtacggaaggatggtctcct
ttccgtgatttcatttcacgtagcggatcatggtatgcgcggacgatgctggggattggc
gtgcgcgatatgaccgcaggtttccgagcctaccgcgcatcgatgttgcgttccctggat
ttggacgcgattgaagcgaacggctacgtgttccagattgacatgacccgtcgcgtggcg
gccgcgggtggaacaatcgtggaggtgccgatcgtgttccccgatcgggtgcgaggcaaa
tcgaaaatgagcaacgccatcgttatcgaggcgatgcgtcgcgtcaccgtctggggcttg
cagcgactgttccataagtga

DBGET integrated database retrieval system