KEGG   Bifidobacterium dentium Bd1: BDP_1803Help
Entry
BDP_1803          CDS       T01143                                 

Gene name
lplA
Definition
(GenBank) LplA lipoate-protein ligase A
  KO
K03800  
lipoate---protein ligase [EC:6.3.1.20]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    BDP_1803 (lplA)
Enzymes [BR:bde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.20  lipoate---protein ligase
     BDP_1803 (lplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2058862..2059938)
Genome map
AA seq 358 aa AA seqDB search
MMGRGVYKQPGGKLVGVTARLRDGYCHIDGDFFIDGNEDRAHEMLLDIERTLVAGRSIRG
IPQQYPDVALVGMTMQGIETAFRRAVTQDDPVPQERASQTSLPRIASSRASHHTSTGDEF
GELTAVECAARWRSLKPTVLHDAPCSPQEQMDTDLQWAREVAAGSRKATLRIWEWAAPAV
VIGRFQSLPDEVNEQAAQAEGIQIVRRCTGGGAMFIEPGNTITYSLYAPLDFAKGVSIED
SYRLCDYWLVTALRELGLDVRFTGLNDIASQYGKIGGAAQRRFPPIDTGPGAILHHVTLA
YDIDGEKMMRVLHVSREKMSDKAVKSAVKRVDPMRSQTGMSRDVVVNHLIAAARRVTI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgatgggcagaggcgtatacaagcagccgggcggtaaactcgtgggggttaccgcccgg
cttcgtgatgggtactgccatatcgacggcgattttttcattgacggcaatgaggatcgt
gcccatgagatgctgcttgatatcgaacggacgttagtcgcgggacggtcgatccgcggc
attccgcaacaatatccggacgttgcactggtcggcatgaccatgcagggaattgaaacg
gcctttcgcagggccgttacgcaagatgaccccgttccccaagagcgggcatcgcaaacg
tcactgccgcgaatcgcatcgtcgcgggcatcgcatcacacttcgacgggcgacgaattc
ggcgagctgacggcagtggaatgcgcggcgagatggcgcagtctcaagccaacggtcctg
catgatgcaccatgcagcccgcaggaacagatggacacggacctgcaatgggcccgcgaa
gtggcggcaggcagtcgcaaagcgaccctgcgcatctgggaatgggccgctccggccgtg
gtgatcggccgattccaatcattgccggacgaggtcaacgagcaggccgcacaagccgaa
ggcatccagatagtgcgacgatgcaccggtggcggcgcgatgttcatcgaaccgggcaac
accatcacctactcgctgtacgcgccgctggatttcgccaaaggcgtgagcatcgaggac
tcctataggctgtgtgactattggcttgtcacggcactgcgcgaacttggtctggacgtg
cggttcaccggattgaacgacatcgcatcgcaatacggcaagatcggcggagcggcgcag
cgcaggttccccccgatcgatactggccccggcgcgatactgcatcatgtgacgctcgcc
tatgacatcgacggcgaaaaaatgatgcgcgtgttgcacgtgtcacgcgagaagatgtcg
gataaagccgtgaaatcagcggtgaagcgcgtcgatccgatgcgctcgcagaccggcatg
agccgtgatgtggtggtgaatcatctgattgccgcggccaggcgcgttacaatatag

DBGET integrated database retrieval system