KEGG   Bifidobacterium dentium Bd1: BDP_1804Help
Entry
BDP_1804          CDS       T01143                                 

Definition
(GenBank) TM2 domain-containing protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2059935..2060672)
Genome map
AA seq 245 aa AA seqDB search
MNDDNTNFTNPDHINGSASADGSTPSNDSQSSYSQYGAEQPAADHSQTTNTQPAADYGSY
GQQSSAQQSYGQTADGTYGSYGSYGQQSGQAYGQNGSYYAQSGQTGQSAYDPNAQQNGYT
QPNAYTQQNAYAQQGYGQPNYTQPNPYAQQYYQPNGQPLPPGYVPRQKIVAGLLGIFLGS
LGIHNFYLGNTTKAVVQLLLTVVGWIILIGPVVASIWGLVEGILILCSDIGSPWHRDGRG
VELRD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgacaacactaatttcaccaaccccgaccacatcaatggttccgcttcggct
gacggatcgaccccatcaaacgattcgcagtcgagctacagccaatacggtgccgaacag
ccggccgccgaccatagccagaccacgaacacgcagccggccgccgactatggttcctac
gggcagcagtcctccgcacagcagagctacggccaaaccgcggatggaacgtatggctca
tacggttcctatgggcagcaatccggccaggcttacggacagaacggctcctattatgcg
cagtccgggcagacgggccagtcggcctatgacccgaacgcccaacagaacgggtatacg
cagccgaacgcatacacccagcagaacgcatacgcgcagcagggctatggacagccgaac
tacactcagccgaacccgtatgcacagcagtactatcagccgaacggccagccgttgcct
ccgggatacgtgccccgccagaagatcgtggccggcctgctcggcattttcctgggcagt
ctgggcatccacaatttctatctcggcaacaccaccaaggccgttgtgcagctactgctg
acggtggtcggatggatcatcctcatcggaccggtagtggccagcatctggggccttgtc
gaaggcattctgattctgtgctccgacatcggttccccgtggcaccgcgacggtcgcggc
gtagagctgcgcgattga

DBGET integrated database retrieval system