KEGG   Bifidobacterium dentium Bd1: BDP_1812Help
Entry
BDP_1812          CDS       T01143                                 

Gene name
trxA
Definition
(GenBank) Thioredoxin
  KO
K03671  
thioredoxin 1
Organism
bde  Bifidobacterium dentium Bd1
Brite
Chaperones and folding catalysts [BR:bde03110]
 Protein folding catalysts
  Protein disulfide isomerase
   BDP_1812 (trxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2070965..2071327
Genome map
AA seq 120 aa AA seqDB search
MATHAVTSENFNEVIEGNDLVFVDFWATWCGPCRAFGPTFEKASEANPDIYFAKVDIDQN
PDLAQAAKVQAVPTLMVVKKQQIVFQQAGALRASDLDDLIGQAKALDVNAAASGRTGAEQ
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcatgcagtcacctctgagaacttcaacgaggtcatcgagggcaacgatctc
gtattcgtggatttctgggccacctggtgcggcccgtgccgcgcgttcggaccgactttc
gaaaaggcgagcgaagcgaaccccgacatctatttcgccaaggtcgatatcgatcagaat
cctgatctcgctcaggcggccaaggtacaggccgttccgacgctgatggtcgtcaagaag
cagcagatcgtgttccagcaggccggcgccctgcgcgcctccgatctggatgatctgatc
ggacaggccaaggcgttggatgtgaacgccgcagcttccggccgcaccggagccgaacag
tag

DBGET integrated database retrieval system