KEGG   Bifidobacterium dentium Bd1: BDP_1814Help
Entry
BDP_1814          CDS       T01143                                 

Definition
(GenBank) Conserved hypothetical secreted protein with G5 domain
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2071545..2072555
Genome map
AA seq 336 aa AA seqDB search
MANHSKHGRPFTLSLPNRSQCVKIVATFAAVGLLATGGIISRSFYTSSTQAEPTTRVTAY
SATDAEASRGNAREALGGDTAYVTVKINGKSRVVPGTNFTNVKSVLEAGNITLEPEDTVS
PSLTTKVDEKTVITVSRAGASVEVSDSSIAFNVVKKETSSLPKGQEKVETEGEEGVMEST
NLVTRSGDTVISSNMISSYVKKAPVDKVVLVGTGSTSTSSSSSSSSSTASVGTTVPAGEM
QQWAHDYLISNGYTEADFTATVYIISHESGWSVSATNPSSGAYGLPQALPGSKMVSAGAD
WATNYQTQLKWFWGYCASRYGSIQGAYSYWLAHKCY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggctaaccacagcaagcatggacgcccgtttaccctgagcctgccgaacaggtcccag
tgtgtgaagatcgtcgcaacgttcgcggcggtggggctgctggctaccggtggcattatt
tcacgtagtttctatacgtcatccacccaggcggagccgaccacgcgtgtcaccgcctat
tccgccaccgatgccgaagcgtcccgtggcaacgcccgtgaggctctcggcggtgatacc
gcatatgtcaccgtgaagatcaacggcaagtcccgcgtggtgccgggcaccaatttcacc
aacgtcaagtccgtgctggaagccggcaacatcacgcttgaaccggaagacaccgtctcc
ccgtcgctgaccaccaaagtcgatgagaagaccgtaatcaccgtcagccgtgcaggtgct
tccgtcgaggtctccgactcgtcgatcgcattcaatgtcgtgaagaaggagacttcctcc
ctgccgaagggccaggagaaggtcgagaccgaaggcgaggaaggcgtgatggaatccacg
aacctcgtaactcgctccggtgacaccgtcatctcctcgaatatgatcagctcgtacgtg
aagaaagctccggtcgacaaggtggttctcgtcggtaccggctccacttccacgtcatcg
tcgtcttcttcgtccagcagcaccgcttcggtcgggaccaccgtgccggctggcgagatg
cagcagtgggcccatgactatctgatttccaacggttataccgaggccgatttcaccgcg
accgtgtacatcatctcgcatgaatccggctggagcgtgtccgccacgaatccaagttcc
ggcgcgtatggcctgccgcaggcactgcccggcagcaagatggtcagcgccggcgccgac
tgggccaccaactaccagacccagctcaagtggttctggggttactgcgcctcacgctac
ggctccattcaaggtgcctacagctattggctcgcccataagtgctactga

DBGET integrated database retrieval system