KEGG   Bifidobacterium dentium Bd1: BDP_1825Help
Entry
BDP_1825          CDS       T01143                                 

Definition
(GenBank) Acetyltransferase
  KO
K00640  
serine O-acetyltransferase [EC:2.3.1.30]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bde00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BDP_1825
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BDP_1825
Enzymes [BR:bde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     BDP_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2084378..2084947
Genome map
AA seq 189 aa AA seqDB search
MIQTKQDLCRFLSAERGAYLYGGRMDTLLAYLTDDPRAQIWRFQKRLRVCEYRYNNRHKT
PLHYVMFLWARRRKNRLGSRLGIEISENIFDEGLRLYHYGNIVVNGDTRIGKNCVLHGAN
CIGNAAKDFAAPHLGDDIDIGVGASIIGGVTIADGTIIGAGAVVTRSIPHKSTTVVGIPA
KPIRRGENI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgattcagacaaaacaagacttatgccgcttcctatccgcggaacggggcgcttacctg
tacggcggccgtatggatacactcctcgcctatctcaccgatgatccaagagctcagatt
tggcgtttccagaaacgtctgcgcgtatgtgaataccgatacaataaccggcataagacc
ccacttcattacgtaatgtttttatgggcgcgcaggaggaagaaccgtctaggaagccgt
cttggcatagagatttccgaaaatatcttcgatgaggggcttcgcctgtatcattacggc
aacattgtcgttaatggagacacacgaatcggcaaaaactgcgtgctgcacggtgccaat
tgcatagggaacgcggctaaagacttcgcagcacctcatttaggagacgatattgacatt
ggcgtcggagcatccatcatcggcggcgtgacgatagcggatggaacgatcatcggggcg
ggagccgtcgtcactcgctccataccgcataagagcaccactgtggtcggcattccggcc
aaaccgatacggaggggtgaaaacatatga

DBGET integrated database retrieval system