KEGG   Bifidobacterium dentium Bd1: BDP_1828Help
Entry
BDP_1828          CDS       T01143                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2088141..2089541
Genome map
AA seq 466 aa AA seqDB search
MFVAYSALTLAMIPLHEPWRDESQAWLISRDASLGDLFGSILREEGHPALWFLMLMPFAK
MGAPYVSMQIISAVLMIAALTILYVSDIPVAVKLLAPVTCLFVYEIPTIARSYSVLALSC
ALIIADYPHRDKHPYRYALWLALLFQTHVWAFGFTGSMLIVWLYDMARNRTLRARKNYTA
LLLPVLSALLAAIELFPNGSNTPQITPLANWYLSKEGLLCIVLFIIASSFSAVFVSLCTV
AWVTVVINLVYFGVNAQKNCALLWMLAAVALTLMLHDARNKAANHSRFQRVITIGVAVAL
ALTLVPKTRVAWQDALQDAHTITSIGAQFAHTLDDDIESTGSDVIVPVRDATSVYAVSNS
LPYMNADVQMWNPFTKTHLSYADQQYRNLSATAGKPSLHTSDLPRNTDTGKMLFVDCTGA
DGTGQPDILSHNPRYHKISRTSSQSAYNDRLNPDVTGISCSVYRHN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcgcatattcagcgctgactctggcaatgataccgttgcacgaaccgtggcgt
gacgagtcgcaggcatggctcatttcccgcgacgcttcactgggcgacctgttcggcagc
atactgcgcgaagagggacacccggcactctggttcctgatgctgatgccgttcgccaaa
atgggagcgccatacgtcagcatgcagatcatcagcgccgtgctcatgatcgcggcgctg
acaatcctatacgtgtccgacattccggtggctgtcaaactgcttgcccccgtcacctgt
ctgttcgtgtacgaaatccccacgatcgcccgctcctacagcgtgctggctttgtcatgc
gccttaattattgcggattatcctcatcgggacaagcatccttaccggtatgcgctatgg
ttggccctgctcttccaaacccatgtgtgggcttttggctttaccggtagcatgctcatc
gtctggctgtacgacatggcccgcaaccgcactctgcgcgcaaggaaaaactacaccgcc
ctactgttgcccgtattgagcgccctgctggcggcaatcgagcttttccccaatggcagc
aatactccgcagatcacgcctctggcaaactggtatctgtccaaggaaggattgctttgt
atcgtattgttcatcatagcttccagctttagcgcagtattcgtctccctgtgcacggtg
gcatgggtgacggtggtgatcaacctcgtctatttcggcgtcaacgcccagaaaaactgt
gctctgctctggatgctggccgccgtggcattgacattgatgcttcatgatgcccgaaac
aaagccgccaaccacagccgcttccaacgcgtaataaccattggcgtggctgtggcgctg
gcacttaccctagtgcctaagacacgcgtcgcatggcaggatgctctgcaggacgcccac
accatcacttcgatcggagcacaattcgcccacacgcttgacgatgacatcgaatcgaca
ggaagcgacgtcatcgtgccggtccgggatgccacctcggtatatgcggtaagcaactcg
ctgccatatatgaacgctgatgtccaaatgtggaatcctttcaccaagacccatctaagt
tatgccgatcagcagtatcgtaacctcagcgccaccgctggcaagccaagcctccacacc
agtgatttacctagaaacaccgatacaggcaaaatgcttttcgtggattgcaccggtgcc
gatggcaccggccagccggatatactcagtcacaatcctcgataccataaaatcagccgg
actagcagccagtcggcgtataacgacaggctgaacccggatgtcaccggcatcagctgc
agcgtataccgacataactga

DBGET integrated database retrieval system