KEGG   Bifidobacterium dentium Bd1: BDP_1829Help
Entry
BDP_1829          CDS       T01143                                 

Definition
(GenBank) Hypothetical transmembrane protein possibly involved in polysaccharide biosynthesis
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2089561..2091090
Genome map
AA seq 509 aa AA seqDB search
MNKNKQFIINLAASLVNFAVNMGIGFVITPFIVGRVGAEAYGFAGLANTMVGYATLFTIA
LNSVAGRFITVAYHQGDKRKADTYFSSTLAANLVMTLILTVVAVPLIVNLEYVIHISPRL
VTDVKWLFGFVYLNFVVATMSSVLSVATFIKNRLHLSSLANIAFSMVRIIAMVVCFALFP
TYVMFVGLATCLAQIVLAALNYLFTVRLTPELRIDRKAISLRAAWTMLASGIWNTVIKLQ
QILQNGLSLLIANLAISPLHMGYLSVAQVVPNALVNLIGTISGLFSPEQTKLYSQKHHDA
LLSELKAGMRITGLFTNIIVVTLLVNGSAFIALWQPGQNTRMIYLLMMLTMSGFFFTGIA
STLQAVPLLVNRLRNYSLSWLACGVLSLSATLVCVKFSNWGIYAVAAIPQFVDILANVTF
VPVYAALCLRLPWSRFYCVYAQYLVSTILAATLGALANILLSIPQTNWIGLLASCAITAL
LTLASDLLLLLGERERTMILRKLTRRNRP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaacaagcaattcatcatcaacctcgctgcctcattggtgaactttgccgtc
aatatgggcatcggcttcgtcatcacaccgttcatcgtcggcagagtgggagccgaagcg
tacggctttgcaggattggccaacacaatggtggggtatgcgacgctgttcaccatagcc
ttgaattccgtcgcgggacggttcatcaccgtagcctatcatcagggagacaaacgcaag
gccgacacatatttctcctcaacccttgccgcaaaccttgttatgactctaatattgacg
gtggtggctgttccgctcatcgtcaatctcgagtatgtcatccacatctcaccccgcctg
gtgaccgatgtcaaatggctgttcggcttcgtctacctcaatttcgtcgttgccacgatg
tcttccgtactgtccgtggcgacattcattaagaacaggctgcacctgtccagtttggcc
aatatcgcgttttccatggtcagaatcattgccatggtggtgtgttttgcgctattccca
acctacgtgatgtttgtcggtctagccacttgtcttgcacaaatcgttctggcagcattg
aactacctgttcaccgttcgtcttactcccgagctacgcattgaccggaaggccatctca
cttcgcgccgcatggacaatgctggccagcggcatctggaacaccgtaatcaaattgcaa
cagattctgcaaaatggcctcagcctgctcatcgcgaatctcgccatcagcccattgcat
atgggctacttgtccgtcgctcaagtcgtccccaacgccttggtgaatctcataggcacc
atttccggcttgttctctcccgaacagaccaagctctattctcagaagcaccatgatgcg
ctcctgagcgagctcaaggcaggaatgcgtatcacaggattattcacaaacatcatcgta
gtgacattattggtcaatggttcggcattcatcgccctatggcagcccggacagaatact
cgcatgatctacctgctgatgatgctgaccatgagcggtttcttcttcaccggcatagcg
agcacactgcaagcggttcccctgctggtgaacagattacgtaattactcactcagctgg
ttggcatgcggcgttctctcgctttccgcgacgttagtctgcgtcaaattctccaattgg
ggcatctatgcggtcgcggccatcccgcaattcgtcgatatactcgcgaacgtcactttc
gtgcccgtatacgcggccctctgccttcgactgccatggtcgaggttctattgcgtatat
gcgcaatatcttgtctccaccatactggcggccaccctcggcgcactcgctaacatattg
ctgagcattccgcaaaccaattggatcgggctgctggcgtcatgcgcgataaccgcattg
ctgacactcgcatcagacctgcttctgctgcttggggaacgggaaagaacgatgattctg
cgcaaactgacgcgacgaaacagaccctga

DBGET integrated database retrieval system