KEGG   Bifidobacterium dentium Bd1: BDP_1831Help
Entry
BDP_1831          CDS       T01143                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2092239..2094200
Genome map
AA seq 653 aa AA seqDB search
MKNKQRIQRNVPSEIAAHRVSCYVAAALLLIWCVLLIIPPTRSFAVQLLGICGFCGVCIG
TLRLTSLWPAIRFLRAKSVAAIAVASIAAVVFYAWYFSLYHYYPTWDRINYWSMTVRFNA
ETSTSLVHTIKDVYWSINNSDYNDLLCWVAALPTRLAPQWTTTFFVLTILFLLPASFIIT
TFVYMHAATSTQCQTMVLVTIYAAILCLPAFVRPVLIGYDDVVVLLLFVIVLAGVFDSHI
LHSTPLRIALGIGLAGTFLLRRWFIYACLGLTVAAIVYWGCKIALTTANCRRTLFSALIR
AMLTIGVTTVVCLVPFPGFLRKSLFGNQSVAYQAWTIFTSYQAKFINIGQTVGWLWLAIA
VAGLAFTAFTGFRHHESHLLQLTSLQGAMLVGAAVGALLFWQIQDFSPQHWYIVCVFIIV
SYCLPLVSWLNVIQGTVAGRVASAGVVLVSLIGLCHGIGAFTFPEPVDRALSYVTGTTIT
TPTRSNDLAEKRQLVSYLRQQTKGKRLVYFAAASDDLNSTLPFSTCLPECIVSPFPVANA
DVDSYSGFNMQFFDAQYVVVSQPVSLHMNPNNEQLVTTLNKTVQNSNSVVGKHYTKMKAF
TFDHGVTAIVYARTSEYSRADIQQIAKIIGNLNSPSQSLFRQQFREYLASKEH
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataaacagcggattcagcgcaacgtcccatcagaaattgccgcgcatcgcgta
tcctgctacgtggccgcggcgctcctcctcatatggtgcgtgctgctgatcattcctccg
actcgctcgttcgccgttcagctgcttggaatatgcggcttctgcggagtttgcatcggc
acgctacggcttacatcgctttggccggcaatacggttccttcgcgccaaaagcgttgca
gcgattgctgtggcatccatcgcggcggtcgtgttttacgcttggtatttctcgctgtac
cattattaccccacatgggatcgaatcaattattggtccatgactgtccgtttcaacgcg
gagacttccacatccctcgtacacacgataaaagacgtctattggtccatcaacaattca
gattacaacgacctgctctgctgggtcgcagcactgcctacgcgccttgccccacaatgg
acgacgaccttcttcgtccttacgatattgttcctgttgccggcaagcttcatcatcacc
acgtttgtatacatgcatgcggcgacatccacgcagtgtcagacgatggtcctcgtcacc
atctatgccgccatcctctgtcttcccgcattcgtccgtcccgttctcatcggatatgat
gacgtcgtcgtcctattgttattcgtcatcgtattggccggcgtgttcgattcccacatt
cttcattcgacgccgctccgtatcgcgcttggcatcggtttggcgggaacgttcctgctc
cgccgttggttcatttatgcctgtctgggactgaccgtcgccgcaatcgtatattgggga
tgcaaaatcgcgctcaccaccgcgaactgccgacgtaccctgttctccgcgctgatccgc
gccatgctgaccataggcgtcacaacggtagtttgtctggttccgttccccggattcctt
cggaaatcactgttcggcaaccaatccgtcgcatatcaggcatggacgatattcacctcc
taccaggccaaattcatcaatattggtcagaccgtcggatggctatggctggcgatcgct
gttgcgggattggcgttcaccgcattcacaggcttccggcaccatgaatcgcatctgctc
caactgacgtcgttgcaaggcgccatgttggttggcgccgctgtcggggctttgctgttc
tggcaaattcaggatttcagcccgcagcattggtatatcgtctgtgtgttcatcatcgtc
tcctactgtctgccgcttgtctcctggcttaacgtcatccaaggaaccgtggccggtcgc
gtggcgtccgctggcgttgtgctggtttcccttatcgggctttgccatggcattggagcg
ttcacgttcccggagcctgtggatcgagcattgtcgtacgtcaccggcacaaccatcacc
actcccaccaggagcaatgatcttgccgagaagcggcagttggtctcctatctccggcag
cagaccaaaggcaagcgactggtgtatttcgccgccgccagcgacgatctcaactcaacg
ttgccgttttcgacatgcctgccggaatgcatcgtgtccccgttccccgtggccaatgcc
gatgtcgattcctacagcggtttcaacatgcaattcttcgacgcgcaatatgtcgtagtc
tcgcaacccgtgtcattgcatatgaatccgaataacgagcagcttgtcacaacgttgaat
aagaccgtacagaactccaatagcgttgtgggcaagcactacaccaagatgaaggcattc
acattcgatcatggggtgacggcaatcgtgtatgcccgcacttccgaatattcccgtgcc
gatatacagcagatagcgaaaatcatcggcaatctgaattcgccttcccaatcgctgttc
agacagcaattccgtgagtatcttgcgtccaaggaacactaa

DBGET integrated database retrieval system